A0A397Y1M6 · A0A397Y1M6_BRACM
- ProteinSerine/threonine-protein kinase BSK
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids336 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Serine/threonine kinase that acts as positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | ATP binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | brassinosteroid mediated signaling pathway |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein kinase BSK
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Brassiceae > Brassica
Accessions
- Primary accessionA0A397Y1M6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Membrane ; Lipid-anchor
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MKWAMRLRVALHIAQA | ||||||
Chain | PRO_5017378022 | 17-336 | Serine/threonine-protein kinase BSK | |||
Sequence: LEYCTGKGRALYHDLNAYRVLFDDDSNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSHALDLIRDRNIQMLIDSCLEGQFSSDDGTELVRLASRCLQYEPRERPNPKSLVTAMIPLQKDLETPSHQLMGIPSSASTTPLSPLGEACLRTDLTAIHEIVEKLGYKDDEGAATELSFQMWTNQMQDSLNFKKKGDVAFRHKDFANAAECYSQFIEGGTMVSPTVYARRSLCHLMNDMPQEALNDAMQAQVISPAWHIASYLQAVALSALGQENEAHAALKDGSMLESKRNAL |
Keywords
- PTM
Interaction
Subunit
Interacts with BRI1.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-174 | Protein kinase | ||||
Sequence: MKWAMRLRVALHIAQALEYCTGKGRALYHDLNAYRVLFDDDSNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSHALDLIRDRNIQMLIDSCLEGQFSSDDGTELVRLASRCLQYEPRERPNPKSLVTAMIPLQKDLETPSHQLM |
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length336
- Mass (Da)37,452
- Last updated2018-12-05 v1
- Checksum62C10BE418053945