A0A385CIE4 · A0A385CIE4_GOSHI
- ProteinExpansin
- GeneEXPA16A
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids293 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | membrane | |
Biological Process | anatomical structure morphogenesis | |
Biological Process | plant-type cell wall organization |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameExpansin
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Malvales > Malvaceae > Malvoideae > Gossypium
Accessions
- Primary accessionA0A385CIE4
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MAAPKISLTLLCFTSLLPFFTSVNA | ||||||
Chain | PRO_5017103137 | 26-293 | Expansin | |||
Sequence: RIPGVFSTGSWETAHATFYGGSDASGTMGISQITIPSPPSKSHIFMTLHLIGFSFCCFLGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALRSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTVNGFRYFNLVLITNVAGAGDIVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPPNWQFGQTFTGKNFRI |
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 85-199 | Expansin-like EG45 | ||||
Sequence: GGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALRSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGG | ||||||
Domain | 209-288 | Expansin-like CBD | ||||
Sequence: YFNLVLITNVAGAGDIVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPPNWQFGQTFTG |
Sequence similarities
Belongs to the expansin family. Expansin A subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length293
- Mass (Da)31,784
- Last updated2018-12-05 v1
- Checksum518164324BBE2B3C