A0A354AAG6 · A0A354AAG6_9GAMM
- ProteinDNA topoisomerase 4 subunit B
- GeneparE
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids631 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circular DNA molecule.
Catalytic activity
Cofactor
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 6 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 43 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 70 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 111-117 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GLHGVGI | ||||||
Binding site | 335 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Site | 447 | Interaction with DNA | ||||
Sequence: N | ||||||
Site | 498 | Interaction with DNA | ||||
Sequence: H | ||||||
Site | 616 | Interaction with DNA | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Molecular Function | DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity | |
Biological Process | chromosome segregation | |
Biological Process | DNA topological change |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA topoisomerase 4 subunit B
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Erwiniaceae > Erwinia
Accessions
- Primary accessionA0A354AAG6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 413-526 | Toprim | ||||
Sequence: TELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSEDLSQLRYGKICILADADSDGLHIATLLCALFVRHFSTLVKNGHVYVAMPP |
Sequence similarities
Belongs to the type II topoisomerase GyrB family.
Belongs to the type II topoisomerase family. ParE type 1 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length631
- Mass (Da)69,931
- Last updated2018-11-07 v1
- Checksum844EC5520320E61A
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
QGAC01000013 EMBL· GenBank· DDBJ | TKJ88982.1 EMBL· GenBank· DDBJ | Genomic DNA |