A0A353PYX2 · A0A353PYX2_9CLOT
- ProteinCoenzyme A biosynthesis bifunctional protein CoaBC
- GenecoaBC
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids396 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes two sequential steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine. In the second step the latter compound is decarboxylated to form 4'-phosphopantotheine.
Catalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine, in the latter compound is decarboxylated to form 4'-phosphopantotheine.
Catalytic activity
- (R)-4'-phosphopantothenate + CTP + L-cysteine = CMP + diphosphate + H+ + N-[(R)-4-phosphopantothenoyl]-L-cysteine
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 FMN per subunit.
Pathway
Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 2/5.
Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 3/5.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 156 | Proton donor | ||||
Sequence: C | ||||||
Binding site | 277 | CTP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 287 | CTP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 321 | CTP (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 335 | CTP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 339 | CTP (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | FMN binding | |
Molecular Function | metal ion binding | |
Molecular Function | phosphopantothenate--cysteine ligase activity | |
Molecular Function | phosphopantothenoylcysteine decarboxylase activity | |
Biological Process | coenzyme A biosynthetic process | |
Biological Process | pantothenate catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCoenzyme A biosynthesis bifunctional protein CoaBC
- Alternative names
Including 2 domains:
- Recommended namePhosphopantothenoylcysteine decarboxylase
- EC number
- Short namesPPC decarboxylase ; PPC-DC
- Alternative names
- Recommended namePhosphopantothenate--cysteine ligase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Bacillota > Clostridia > Eubacteriales > Clostridiaceae
Accessions
- Primary accessionA0A353PYX2
Proteomes
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-188 | Phosphopantothenoylcysteine decarboxylase | ||||
Sequence: MTQKTVVIGVTGGIAAYKALDVISSLKKENVNVHVIMTSNAAKFVSPLSFQTLSQNFVITDMFAEPRTIEVEHISLAKKADLFAVIPATANIIGKVACGIADDMLTTTIMATKSPVLFAPAMNTNMYNNPIVKENILKLKKIGYDFIEPDSGRLACGDIGIGKLADTNKITDIINMYLYSPKDFLGKN | ||||||
Domain | 4-166 | Flavoprotein | ||||
Sequence: KTVVIGVTGGIAAYKALDVISSLKKENVNVHVIMTSNAAKFVSPLSFQTLSQNFVITDMFAEPRTIEVEHISLAKKADLFAVIPATANIIGKVACGIADDMLTTTIMATKSPVLFAPAMNTNMYNNPIVKENILKLKKIGYDFIEPDSGRLACGDIGIGKLAD | ||||||
Domain | 186-366 | DNA/pantothenate metabolism flavoprotein C-terminal | ||||
Sequence: GKNVLVTAGPTREDIDPVRFITNKSSGKMGYALARALRDRGANVTLISGPSNLEPPERINFIKVYSAEDMFNQVMEHFDENEIIIKSAAVADYSPENVSSIKIKKSDNDLSIKLKRNRDILYELGRRKKNQILVGFAAETNDMIQNAQEKIKKKNLDMIVANDVTVKGSGFQCDTNTVKII | ||||||
Region | 189-396 | Phosphopantothenate--cysteine ligase | ||||
Sequence: VLVTAGPTREDIDPVRFITNKSSGKMGYALARALRDRGANVTLISGPSNLEPPERINFIKVYSAEDMFNQVMEHFDENEIIIKSAAVADYSPENVSSIKIKKSDNDLSIKLKRNRDILYELGRRKKNQILVGFAAETNDMIQNAQEKIKKKNLDMIVANDVTVKGSGFQCDTNTVKIIKSNGDIVSLPNMTKYEAAHKILDNIIDLER |
Sequence similarities
In the C-terminal section; belongs to the PPC synthetase family.
In the N-terminal section; belongs to the HFCD (homo-oligomeric flavin containing Cys decarboxylase) superfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length396
- Mass (Da)43,628
- Last updated2018-11-07 v1
- Checksum4DCA1E0F254E619C
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DNIJ01000028 EMBL· GenBank· DDBJ | HAZ36390.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DNSA01000132 EMBL· GenBank· DDBJ | HBF78000.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DNQV01000031 EMBL· GenBank· DDBJ | HBG37958.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DOCJ01000005 EMBL· GenBank· DDBJ | HBN27456.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DORL01000066 EMBL· GenBank· DDBJ | HBX47840.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DPWX01000144 EMBL· GenBank· DDBJ | HCL51226.1 EMBL· GenBank· DDBJ | Genomic DNA |