A0A346DKW0 · A0A346DKW0_VACCO
- ProteinLon protease homolog, mitochondrial
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids993 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner.
Catalytic activity
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | ATP-dependent peptidase activity | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | serine-type endopeptidase activity | |
Molecular Function | single-stranded DNA binding | |
Biological Process | cellular response to oxidative stress | |
Biological Process | chaperone-mediated protein complex assembly | |
Biological Process | mitochondrion organization | |
Biological Process | oxidation-dependent protein catabolic process | |
Biological Process | protein quality control for misfolded or incompletely synthesized proteins |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLon protease homolog, mitochondrial
- EC number
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > Ericales > Ericaceae > Vaccinioideae > Vaccinieae > Vaccinium
Accessions
- Primary accessionA0A346DKW0
Subcellular Location
Interaction
Subunit
Homohexamer or homoheptamer. Organized in a ring with a central cavity.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 105-316 | Lon N-terminal | ||||
Sequence: VLALPLPHRPLFPGFYMPIYVKDPKLLAALVESRKRQAPYAGAFLLKDEPGTDPSAASGSDADKNIYELKGKELFNRLNEVGTLAQITSIQGDQVVLIGHRRLRITELVSEDPLTVKVDHLKDKPYDKDDDVVKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFNYSRLADFGAAISGANKSQCQQVLEELDVYKRLKLTLELVKKEM | ||||||
Domain | 803-987 | Lon proteolytic | ||||
Sequence: QTPAGVVMGLAWTAMGGSTLYIETTLVEQSEGKGALHVTGQLGDVMKESTQIAHTVARAILLEKDPENTFFANSKLHLHVPAGATPKDGPSAGCTMITSLLSLALKKPVKKDIAMTGEVTLTGKILPIGGVKEKTIAARRSDVKTIIFPSANRRDFDELAPNVKDGLEVHFVDDYNQIFDVAFAD |
Sequence similarities
Belongs to the peptidase S16 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length993
- Mass (Da)109,510
- Last updated2018-11-07 v1
- ChecksumD48EBD17741FCEF9