A0A2Z5RE15 · A0A2Z5RE15_9NEOP
- ProteinATP-dependent 6-phosphofructokinase
- GeneRsPFK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids794 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.
Catalytic activity
- ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H+
Cofactor
Activity regulation
Allosterically activated by ADP, AMP, or fructose 2,6-bisphosphate, and allosterically inhibited by ATP or citrate.
Pathway
Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 32 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 95-96 | ATP (UniProtKB | ChEBI) | ||||
Sequence: RC | ||||||
Binding site | 125-128 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GDGS | ||||||
Binding site | 126 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 171-173 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: SID | ||||||
Active site | 173 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 208 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 215-217 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: MGR | ||||||
Binding site | 271 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: E | ||||||
Binding site | 299 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 305-308 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: HVQR | ||||||
Binding site | 485 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: R | ||||||
Binding site | 542-546 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: TISNN | ||||||
Binding site | 580 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 587-589 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: MGG | ||||||
Binding site | 643 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: E | ||||||
Binding site | 669 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 675-678 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: HMQQ | ||||||
Binding site | 751 | beta-D-fructose 2,6-bisphosphate (UniProtKB | ChEBI); allosteric activator; ligand shared between dimeric partners; in other chain | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | 6-phosphofructokinase complex | |
Molecular Function | 6-phosphofructokinase activity | |
Molecular Function | AMP binding | |
Molecular Function | ATP binding | |
Molecular Function | fructose-6-phosphate binding | |
Molecular Function | identical protein binding | |
Molecular Function | metal ion binding | |
Molecular Function | monosaccharide binding | |
Biological Process | canonical glycolysis | |
Biological Process | fructose 1,6-bisphosphate metabolic process | |
Biological Process | fructose 6-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent 6-phosphofructokinase
- EC number
- Short namesATP-PFK ; Phosphofructokinase
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Polyneoptera > Dictyoptera > Blattodea > Blattoidea > Termitoidae > Rhinotermitidae > Reticulitermes > Frontotermes
Accessions
- Primary accessionA0A2Z5RE15
Subcellular Location
Interaction
Subunit
Homotetramer.
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-397 | N-terminal catalytic PFK domain 1 | ||||
Sequence: MSSSPSAVYDNKRFIERGSHKGKGLAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFIKEGYQGMVDGGDNIVEATWSSVSSIIHKGGTIIGSARCQEFRERSGRLKAAKNLVARGITNLVVIGGDGSLTGANLFRSEWSSLLDELVQSGQITKEQQTKFAHLHIAGMVGSIDNDFCGTDMTIGTDSALHRITEAIDAIASTAYSHQRTFIMEVMGRHCGYLAIVTALTSEADYVFVPEMPPPRDWPTKLCSKLEQERSTGQRLNIIIVAEGAIDQDGEPITAEKVRQVVVENLQQDTRITVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEATPETESCVVSLDGNQAVRLPLMECVEKTKAVTKAMASKDWENAVQLRGKSFVRNLETYKMLTR | ||||||
Domain | 25-330 | Phosphofructokinase | ||||
Sequence: LAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFIKEGYQGMVDGGDNIVEATWSSVSSIIHKGGTIIGSARCQEFRERSGRLKAAKNLVARGITNLVVIGGDGSLTGANLFRSEWSSLLDELVQSGQITKEQQTKFAHLHIAGMVGSIDNDFCGTDMTIGTDSALHRITEAIDAIASTAYSHQRTFIMEVMGRHCGYLAIVTALTSEADYVFVPEMPPPRDWPTKLCSKLEQERSTGQRLNIIIVAEGAIDQDGEPITAEKVRQVVVENLQQDTRITVLGHVQRGGNPSAFDRVLGCRMGAEAVMA | ||||||
Region | 416-794 | C-terminal regulatory PFK domain 2 | ||||
Sequence: NLAVMHIGAPACGMNAAVRSFVRNCIYRGDTALGIHDGIEGLLAGNVQNMGWADVTGWVAQGGAILGTKRTLPKSRMAQVAARLAEFKIHGLLIIGGFEAYQAALQMHEARPEYQEFCIPIVVIPSTISNNVPGTDFSLGCDTALNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATVAGLAGGADAAYIFEEKFSIEDLRQDLYHMAAKMAEGVQRGLILRNEKANDNYNTDFIYRLYTEEGKGQFSARQNILGHMQQGGSATPFDRNMGTKMASKAVDGLLEQLKLAERRSDGSIYINTPESAVMMGVIRRQYRLTPLEALKSETDFEHRIPKNQWWLKLRPLLRILAKHESAYEEEGMYMTVEDTTVAEGVI | ||||||
Domain | 417-700 | Phosphofructokinase | ||||
Sequence: LAVMHIGAPACGMNAAVRSFVRNCIYRGDTALGIHDGIEGLLAGNVQNMGWADVTGWVAQGGAILGTKRTLPKSRMAQVAARLAEFKIHGLLIIGGFEAYQAALQMHEARPEYQEFCIPIVVIPSTISNNVPGTDFSLGCDTALNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATVAGLAGGADAAYIFEEKFSIEDLRQDLYHMAAKMAEGVQRGLILRNEKANDNYNTDFIYRLYTEEGKGQFSARQNILGHMQQGGSATPFDRNMGTKMASKAVDG |
Sequence similarities
Belongs to the phosphofructokinase type A (PFKA) family. ATP-dependent PFK group I subfamily. Eukaryotic two domain clade "E" sub-subfamily.
Belongs to the phosphofructokinase type A (PFKA) family. ATP-dependent PFK group I subfamily. Eukaryotic two domain clade 'E' sub-subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length794
- Mass (Da)87,037
- Last updated2018-10-10 v1
- Checksum5C45455BB6B17F4D