A0A2U8ZUM6 · A0A2U8ZUM6_9HELO

  • Protein
    DNA replication licensing factor MCM7
  • Gene
    MCM7
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Inferred from homology
  • Annotation score
    4/5

Function

function

Acts as component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.

Catalytic activity

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentDNA replication preinitiation complex
Cellular ComponentMCM complex
Cellular Componentnuclear pre-replicative complex
Cellular Componentnuclear replication fork
Molecular FunctionATP binding
Molecular FunctionATP hydrolysis activity
Molecular FunctionATP-dependent H2AZ histone chaperone activity
Molecular FunctionATP-dependent H3-H4 histone complex chaperone activity
Molecular Functionchromatin extrusion motor activity
Molecular Functioncohesin loader activity
Molecular FunctionDNA clamp loader activity
Molecular Functiondouble-stranded DNA helicase activity
Molecular Functionforked DNA-dependent helicase activity
Molecular Functionfour-way junction helicase activity
Molecular Functionsingle-stranded 3'-5' DNA helicase activity
Molecular Functionsingle-stranded DNA binding
Biological ProcessDNA replication initiation
Biological ProcessDNA strand elongation involved in DNA replication
Biological ProcessDNA unwinding involved in DNA replication
Biological Processdouble-strand break repair via break-induced replication
Biological Processpremeiotic DNA replication

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    DNA replication licensing factor MCM7
  • EC number

Gene names

    • Name
      MCM7

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • CBS 303.31
  • Taxonomic lineage
    Eukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Leotiomycetes > Helotiales > Sclerotiniaceae > Sclerotinia

Accessions

  • Primary accession
    A0A2U8ZUM6

Subcellular Location

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain165-205MCM

Sequence similarities

Belongs to the MCM family.

Family and domain databases

Sequence

  • Sequence status
    Fragment
  • Length
    205
  • Mass (Da)
    22,785
  • Last updated
    2018-09-12 v1
  • MD5 Checksum
    07AC50FD5B76865EA3825B0C7016DCC9
TRVSDVKPTVEVNAYTCDRCGCEIFQPVGSKTFGPLVECPSPDCTTNQTKGQLHHSTRASKFQPFQEVKIQEMAEQVPVGHIPRMLTVLCHGALVRRINPGDVVDIAGIFLPTPYTGFKAIRAGLLTDTYLEAQHVTQHKKAYEDLTIDSRVFKRIEQYRASGHVYEYLAKSIAPEIYGHLDVKKALLLLLVGGVTKEMGDGMRN

Features

Showing features for non-terminal residue.

TypeIDPosition(s)Description
Non-terminal residue1
Non-terminal residue205

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
MF964280
EMBL· GenBank· DDBJ
AWO14512.1
EMBL· GenBank· DDBJ
Genomic DNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice.
Help