A0A2R8Z5S7 · A0A2R8Z5S7_PANPA
- ProteinHepatic triacylglycerol lipase
- GeneLIPC
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids469 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Catalyzes the hydrolysis of triglycerides and phospholipids present in circulating plasma lipoproteins, including chylomicrons, intermediate density lipoproteins (IDL), low density lipoproteins (LDL) of large size and high density lipoproteins (HDL), releasing free fatty acids (FFA) and smaller lipoprotein particles. Also exhibits lysophospholipase activity. Can hydrolyze both neutral lipid and phospholipid substrates but shows a greater binding affinity for neutral lipid substrates than phospholipid substrates. In native LDL, preferentially hydrolyzes the phosphatidylcholine species containing polyunsaturated fatty acids at sn-2 position.
Catalytic activity
- 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O = 2,3-di-(9Z)-octadecenoyl-sn-glycerol + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O = di-(9Z)-octadecenoylglycerol + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1,2,3-tributanoylglycerol + H2O = dibutanoylglycerol + butanoate + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + H2O = (9Z-octadecenoyl)-sn-glycero-3-phosphocholine + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-sn-glycerol + H2O = 2-(9Z-octadecenoyl)-glycerol + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + H2O = hexadecanoyl-sn-glycero-3-phosphocholine + hexadecanoate + H+This reaction proceeds in the forward direction.
- 1,3-di-(9Z-octadecenoyl)-glycerol + H2O = 3-(9Z-octadecenoyl)-sn-glycerol + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phospho-L-serine + H2O = sn-glycero-3-phospho-L-serine + (9Z)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-sn-glycero-3-phosphocholine + H2O = sn-glycerol 3-phosphocholine + hexadecanoate + H+This reaction proceeds in the forward direction.
Features
Showing features for active site, binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | high-density lipoprotein particle | |
Molecular Function | 1-acyl-2-lysophosphatidylserine acylhydrolase activity | |
Molecular Function | apolipoprotein binding | |
Molecular Function | heparin binding | |
Molecular Function | lipoprotein lipase activity | |
Molecular Function | lysophospholipase activity | |
Molecular Function | metal ion binding | |
Molecular Function | phosphatidylserine 1-acylhydrolase activity | |
Molecular Function | phospholipase A1 activity | |
Biological Process | fatty acid biosynthetic process | |
Biological Process | triglyceride catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameHepatic triacylglycerol lipase
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Pan
Accessions
- Primary accessionA0A2R8Z5S7
Proteomes
Subcellular Location
Expression
Gene expression databases
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 322-463 | PLAT | ||||
Sequence: YHYQFKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKWENSAVWANVWNTVQTIIPWSTGPRHSGLILKTIRVKAGETQQRSPNRINLGRLNCSLLFCTELFSHDSLAHWS |
Sequence similarities
Belongs to the AB hydrolase superfamily. Lipase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length469
- Mass (Da)52,446
- Last updated2018-06-20 v1
- Checksum1F7D31B94D74EBBB
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8Z9L1 | A0A2R8Z9L1_PANPA | LIPC | 490 | ||
A0A2R8Z5S1 | A0A2R8Z5S1_PANPA | LIPC | 469 | ||
A0A2R8Z5T1 | A0A2R8Z5T1_PANPA | LIPC | 429 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJFE02098416 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AJFE02098417 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |