A0A2R8YFT0 · A0A2R8YFT0_HUMAN
- ProteinOxysterol-binding protein
- GeneOSBPL2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids243 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | lipid binding | |
Biological Process | lipid transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameOxysterol-binding protein
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A2R8YFT0
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 38 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 52 | PRIDE | Phosphoserine | ||||
Sequence: S |
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-60 | Disordered | ||||
Sequence: MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKH | ||||||
Compositional bias | 13-60 | Polar residues | ||||
Sequence: GFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKH |
Sequence similarities
Belongs to the OSBP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length243
- Mass (Da)27,494
- Last updated2018-06-20 v1
- Checksum81FC58713D5FEC1F
Computationally mapped potential isoform sequences
There are 17 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9H1P3 | OSBL2_HUMAN | OSBPL2 | 480 | ||
A0A2R8Y703 | A0A2R8Y703_HUMAN | OSBPL2 | 114 | ||
A0A2R8Y429 | A0A2R8Y429_HUMAN | OSBPL2 | 101 | ||
A0A2R8Y362 | A0A2R8Y362_HUMAN | OSBPL2 | 439 | ||
A0A2R8Y690 | A0A2R8Y690_HUMAN | OSBPL2 | 291 | ||
A0A2R8Y5R1 | A0A2R8Y5R1_HUMAN | OSBPL2 | 370 | ||
A0A2R8Y5B9 | A0A2R8Y5B9_HUMAN | OSBPL2 | 80 | ||
E7ET92 | E7ET92_HUMAN | OSBPL2 | 370 | ||
A0A2R8YDU7 | A0A2R8YDU7_HUMAN | OSBPL2 | 388 | ||
A0A2R8YD49 | A0A2R8YD49_HUMAN | OSBPL2 | 448 | ||
A0A2R8YG53 | A0A2R8YG53_HUMAN | OSBPL2 | 163 | ||
A0A2R8YG59 | A0A2R8YG59_HUMAN | OSBPL2 | 369 | ||
A0A2R8YG95 | A0A2R8YG95_HUMAN | OSBPL2 | 225 | ||
A0A2R8YEX0 | A0A2R8YEX0_HUMAN | OSBPL2 | 413 | ||
H0Y7X4 | H0Y7X4_HUMAN | OSBPL2 | 76 | ||
A0A087WTV1 | A0A087WTV1_HUMAN | OSBPL2 | 180 | ||
A0A087WVV0 | A0A087WVV0_HUMAN | OSBPL2 | 22 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 13-60 | Polar residues | ||||
Sequence: GFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKH |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL078633 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL354836 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471077 EMBL· GenBank· DDBJ | EAW75378.1 EMBL· GenBank· DDBJ | Genomic DNA |