A0A2R8Y7L2 · A0A2R8Y7L2_HUMAN
- ProteinHydroxysteroid 17-beta dehydrogenase 4
- GeneHSD17B4
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids589 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
Pathway
Lipid metabolism; fatty acid beta-oxidation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | peroxisome | |
Molecular Function | oxidoreductase activity | |
Biological Process | fatty acid beta-oxidation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A2R8Y7L2
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 814 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 51 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 118 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 147 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 157 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 166 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 170 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 171 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 190-318 | Peroxisomal multifunctional enzyme type 2-like N-terminal | ||||
Sequence: YAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVG | ||||||
Domain | 337-453 | MaoC-like | ||||
Sequence: IPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN | ||||||
Domain | 481-584 | SCP2 | ||||
Sequence: FEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILK |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length589
- Mass (Da)63,723
- Last updated2018-06-20 v1
- ChecksumE58EA5D2C59DA616
Computationally mapped potential isoform sequences
There are 20 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P51659 | DHB4_HUMAN | HSD17B4 | 736 | ||
A0A2R8Y7W2 | A0A2R8Y7W2_HUMAN | HSD17B4 | 105 | ||
A0A2R8Y674 | A0A2R8Y674_HUMAN | HSD17B4 | 42 | ||
E7ET17 | E7ET17_HUMAN | HSD17B4 | 599 | ||
E7EPL9 | E7EPL9_HUMAN | HSD17B4 | 713 | ||
E7ER27 | E7ER27_HUMAN | HSD17B4 | 500 | ||
A0A2R8YDT8 | A0A2R8YDT8_HUMAN | HSD17B4 | 166 | ||
A0A2R8YD50 | A0A2R8YD50_HUMAN | HSD17B4 | 711 | ||
A0A2R8YCN2 | A0A2R8YCN2_HUMAN | HSD17B4 | 40 | ||
A0A2R8YF45 | A0A2R8YF45_HUMAN | HSD17B4 | 172 | ||
A0A2R8YF39 | A0A2R8YF39_HUMAN | HSD17B4 | 50 | ||
A0A2R8YEG2 | A0A2R8YEG2_HUMAN | HSD17B4 | 59 | ||
A0A804HIR1 | A0A804HIR1_HUMAN | HSD17B4 | 484 | ||
A0A804HIG8 | A0A804HIG8_HUMAN | HSD17B4 | 158 | ||
A0A804HLJ0 | A0A804HLJ0_HUMAN | HSD17B4 | 55 | ||
A0A804HK65 | A0A804HK65_HUMAN | HSD17B4 | 712 | ||
A0A804HK88 | A0A804HK88_HUMAN | HSD17B4 | 144 | ||
A0A804HKU2 | A0A804HKU2_HUMAN | HSD17B4 | 621 | ||
A0A804HKT2 | A0A804HKT2_HUMAN | HSD17B4 | 100 | ||
A0A804HKB5 | A0A804HKB5_HUMAN | HSD17B4 | 173 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC010409 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC024564 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KC877082 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |