A0A2R8VHF7 · TM249_MOUSE
- ProteinCation channel sperm-associated auxiliary subunit TMEM249
- GeneTmem249
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids171 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | CatSper complex | |
Cellular Component | sperm principal piece |
Names & Taxonomy
Protein names
- Recommended nameCation channel sperm-associated auxiliary subunit TMEM249
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionA0A2R8VHF7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell projection, cilium, flagellum membrane ; Multi-pass membrane protein
Note: Predominantly located in the principal piece of the sperm tail.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-2 | Cytoplasmic | ||||
Sequence: ML | ||||||
Transmembrane | 3-17 | Helical | ||||
Sequence: FIICLVFISCNVLRE | ||||||
Topological domain | 18-28 | Extracellular | ||||
Sequence: VKYQETWCFPA | ||||||
Transmembrane | 29-40 | Helical | ||||
Sequence: YGMVIGLWLMLS | ||||||
Topological domain | 41-171 | Cytoplasmic | ||||
Sequence: SIPQRRLVLNHTRGMYHFSIQGRTVCQGPMHLVYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRHLARKLNINYFDYLASSYRHVVRHWPLGASFSPGIVQRKTQVYTKSSVNDLDV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_5015341210 | 1-171 | Cation channel sperm-associated auxiliary subunit TMEM249 | |||
Sequence: MLFIICLVFISCNVLREVKYQETWCFPAYGMVIGLWLMLSSIPQRRLVLNHTRGMYHFSIQGRTVCQGPMHLVYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRHLARKLNINYFDYLASSYRHVVRHWPLGASFSPGIVQRKTQVYTKSSVNDLDV |
Expression
Gene expression databases
Interaction
Subunit
Component of the CatSper complex or CatSpermasome composed of the core pore-forming members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 as well as auxiliary members CATSPERB, CATSPERG2, CATSPERD, CATSPERE, CATSPERZ, C2CD6/CATSPERT, SLCO6C1, TMEM249, TMEM262 and EFCAB9 (PubMed:34225353).
HSPA1 may be an additional auxiliary complex member (By similarity).
The core complex members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 form a heterotetrameric channel (PubMed:34225353).
The auxiliary CATSPERB, CATSPERG2, CATSPERD and CATSPERE subunits form a pavilion-like structure over the pore which stabilizes the complex through interactions with CATSPER4, CATSPER3, CATSPER1 and CATSPER2 respectively (PubMed:34225353).
SLCO6C1 interacts with CATSPERE and TMEM262/CATSPERH interacts with CATSPERB, further stabilizing the complex (PubMed:34225353).
C2CD6/CATSPERT interacts at least with CATSPERD and is required for targeting the CatSper complex in the flagellar membrane (Probable)
HSPA1 may be an additional auxiliary complex member (By similarity).
The core complex members CATSPER1, CATSPER2, CATSPER3 and CATSPER4 form a heterotetrameric channel (PubMed:34225353).
The auxiliary CATSPERB, CATSPERG2, CATSPERD and CATSPERE subunits form a pavilion-like structure over the pore which stabilizes the complex through interactions with CATSPER4, CATSPER3, CATSPER1 and CATSPER2 respectively (PubMed:34225353).
SLCO6C1 interacts with CATSPERE and TMEM262/CATSPERH interacts with CATSPERB, further stabilizing the complex (PubMed:34225353).
C2CD6/CATSPERT interacts at least with CATSPERD and is required for targeting the CatSper complex in the flagellar membrane (Probable)
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length171
- Mass (Da)19,893
- Last updated2018-06-20 v1
- Checksum2BDA38251A8D86FC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAQ4VMS7 | A0AAQ4VMS7_MOUSE | Tmem249 | 235 |
Keywords
- Technical term