A0A2P6NGP8 · A0A2P6NGP8_9EUKA
- ProteinPhosphodiesterase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1036 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Cofactor
Note: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 782 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 782-786 | AMP (UniProtKB | ChEBI) | ||||
Sequence: HNAIH | ||||||
Binding site | 786 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 822 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 823 | AMP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 823 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 823 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 934 | AMP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 934 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 985 | AMP (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COP9 signalosome | |
Cellular Component | membrane | |
Molecular Function | 3',5'-cyclic-nucleotide phosphodiesterase activity | |
Molecular Function | metal ion binding | |
Molecular Function | metallopeptidase activity | |
Biological Process | protein deneddylation | |
Biological Process | signal transduction | |
Biological Process | sorocarp development |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphodiesterase
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Amoebozoa > Evosea > Variosea > Cavosteliida > Cavosteliaceae > Planoprotostelium
Accessions
- Primary accessionA0A2P6NGP8
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 401-422 | Helical | ||||
Sequence: VLIQSAGMYCILTLIIASAELL | ||||||
Transmembrane | 428-444 | Helical | ||||
Sequence: IRLITFVPYFMIFYVIT | ||||||
Transmembrane | 456-476 | Helical | ||||
Sequence: VWEAVLPFYATLIPFAILVFL | ||||||
Transmembrane | 482-501 | Helical | ||||
Sequence: ILVTVLFFSYVMIIYLQSGL | ||||||
Transmembrane | 508-530 | Helical | ||||
Sequence: LMIYILSFLFIYVAAVCVMMVWY | ||||||
Transmembrane | 550-570 | Helical | ||||
Sequence: WQQELTFVCSLAILGIGFLFL |
Keywords
- Cellular component
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-157 | MPN | ||||
Sequence: IKLHPLVIINISDHWTRAKVQNNVKNPRVVGAIVGIQNGRTVEIFNSYELAYKEEGSLVNIDLEYLMMKSEQFKKVFATYDFLGWYSTGSGVTQDDLTTQKQLSEINESPLYLLLDTVAASRPETKDIPISIMESEIRI | ||||||
Region | 363-384 | Disordered | ||||
Sequence: NSRTSNMNDFTPKSSGSRPTTA | ||||||
Coiled coil | 581-615 | |||||
Sequence: LLDRSHKIQTLEQETEELKKEITKYKQEKDDIDLD | ||||||
Domain | 706-1028 | PDEase | ||||
Sequence: VDEGTEKRIEAGLQRIEDWEFNIFEMTDLTEGRPLFATGLALFNRHDFIRKFNINESRLKHFLTVIEDGYDITNPYHNAIHASDVLHALNFFIVKGGLSAYITELDVFSAVIAAIVHDYMHPGLNNAYQINTQSELAVRYNDRSVLESFHVASAFKVLYEDSNNIFSGLTEAQRKEARETIVTMVMATDMAQHFDLLGRFKSKIAGQGFDPKDRKDRLLLLQIAIKCADISNPMRPQAMCNTWAHRVLSEFYKQGDMERKQGLPVSAFMDRGKPAEAKCQIGFIDFIVGPIFEVWTSFLPEVGKLMVNLEQNRIYWKNAMEQN |
Sequence similarities
Belongs to the cyclic nucleotide phosphodiesterase family.
Belongs to the peptidase M67A family. CSN6 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,036
- Mass (Da)117,310
- Last updated2018-05-23 v1
- ChecksumA4E2CB0D1A273B66
Keywords
- Technical term