A0A2M7MH45 · A0A2M7MH45_9BACT
- ProteinRibosomal RNA small subunit methyltransferase A
- GenersmA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids283 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits.
Catalytic activity
- adenosine1518/adenosine1519 in 16S rRNA + 4 S-adenosyl-L-methionine = 4 H+ + N6-dimethyladenosine1518/N6-dimethyladenosine1519 in 16S rRNA + 4 S-adenosyl-L-homocysteine
RHEA-COMP:10232 CHEBI:74411 Position: 1518CHEBI:74411 Position: 1519+ 4 CHEBI:59789 = 4 CHEBI:15378 + RHEA-COMP:10233 CHEBI:74493 Position: 1518CHEBI:74493 Position: 1519+ 4 CHEBI:57856
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 27 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 29 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 54 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 74 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 96 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 113 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity | |
Molecular Function | RNA binding |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibosomal RNA small subunit methyltransferase A
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageBacteria > Candidatus Kuenenbacteria
Accessions
- Primary accessionA0A2M7MH45
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 34-195 | Ribosomal RNA adenine methylase transferase N-terminal | ||||
Sequence: VRDRIIQAAELNKDDLVLEIGPGLGVLTEELIKKSKVVAVELDKKLYFYLTNKIKNLELIQADVLEFLDGKDKFNKVVANLPYQITSHVLRMMLEKNTADEYILMVQREVGERMVAKPGRMSLLSVMAQYYSEPKILFSVSKGNFWPQPKVDSVVVKLKVKS |
Sequence similarities
Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. RsmA subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length283
- Mass (Da)32,050
- Last updated2018-04-25 v1
- ChecksumFB91ACFC50BF356B