A0A2K6GD64 · A0A2K6GD64_PROCO

Function

function

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentendosome
Cellular ComponentNADPH oxidase complex
Molecular Functionelectron transfer activity
Molecular Functionheme binding
Molecular Functionprotein heterodimerization activity
Molecular FunctionSH3 domain binding
Molecular Functionsuperoxide-generating NAD(P)H oxidase activity
Biological Processcytochrome complex assembly
Biological Processestablishment of localization in cell
Biological Processinflammatory response
Biological Processinnate immune response
Biological Processmucus secretion
Biological Processpositive regulation of defense response to bacterium
Biological Processpositive regulation of interleukin-6 production
Biological Processpositive regulation of mucus secretion
Biological Processpositive regulation of phagocytosis
Biological Processpositive regulation of reactive oxygen species biosynthetic process
Biological Processpositive regulation of toll-like receptor 2 signaling pathway
Biological Processpositive regulation of tumor necrosis factor production
Biological Processregulation of release of sequestered calcium ion into cytosol
Biological Processrespiratory burst
Biological Processsuperoxide anion generation

Names & Taxonomy

Protein names

  • Recommended name
    Cytochrome b-245 light chain
  • Alternative names
    • Cytochrome b(558) alpha chain
    • Cytochrome b558 subunit alpha
    • Neutrophil cytochrome b 22 kDa polypeptide
    • Superoxide-generating NADPH oxidase light chain subunit
    • p22 phagocyte B-cytochrome
    • p22-phox

Gene names

    • Name
      CYBA

Organism names

Accessions

  • Primary accession
    A0A2K6GD64

Proteomes

Subcellular Location

Features

Showing features for transmembrane.

TypeIDPosition(s)Description
Transmembrane12-30Helical
Transmembrane36-54Helical
Transmembrane103-124Helical

Keywords

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the p22phox family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    129
  • Mass (Da)
    13,890
  • Last updated
    2018-03-28 v1
  • MD5 Checksum
    0F7B7701C7F781266365A70E6AA7993E
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVFVCLLEYPRGKRAKGSTMERCGQRYMTAVVKLFGPLTRNYYVRALLHLALSVPAGFLLATILGTACLAIASGIYLLVSGVFC

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help