A0A2K5MN88 · A0A2K5MN88_CERAT

Function

function

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytosol
Cellular Componentextracellular region
Molecular Functioncytokine activity
Molecular Functiongrowth factor activity
Molecular Functionleukemia inhibitory factor receptor binding
Biological Processblood vessel remodeling
Biological Processcell morphogenesis
Biological Processcell surface receptor signaling pathway via STAT
Biological Processdecidualization
Biological Processembryo implantation
Biological Processfibroblast proliferation
Biological Processgene expression
Biological Processimmune response
Biological Processleukemia inhibitory factor signaling pathway
Biological Processlung alveolus development
Biological Processlung lobe morphogenesis
Biological Processlung vasculature development
Biological Processmeiotic nuclear division
Biological Processmuscle organ morphogenesis
Biological Processnegative regulation of cell population proliferation
Biological Processnegative regulation of ERK1 and ERK2 cascade
Biological Processnegative regulation of hormone secretion
Biological Processnegative regulation of meiotic nuclear division
Biological Processneuron development
Biological Processpositive regulation of astrocyte differentiation
Biological Processpositive regulation of cell adhesion mediated by integrin
Biological Processpositive regulation of fibroblast proliferation
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of macrophage differentiation
Biological Processpositive regulation of MAPK cascade
Biological Processpositive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
Biological Processpositive regulation of peptidyl-serine phosphorylation of STAT protein
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processpositive regulation of tyrosine phosphorylation of STAT protein
Biological Processregulation of metanephric nephron tubule epithelial cell differentiation
Biological Processresponse to hypoxia
Biological Processsomatic stem cell population maintenance
Biological Processspongiotrophoblast differentiation
Biological Processstem cell differentiation
Biological Processtrophoblast giant cell differentiation

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Leukemia inhibitory factor

Gene names

    • Name
      LIF

Organism names

Accessions

  • Primary accession
    A0A2K5MN88

Proteomes

Subcellular Location

Keywords

  • Cellular component

PTM/Processing

Features

Showing features for signal, chain.

TypeIDPosition(s)Description
Signal1-22
ChainPRO_501441668923-202Leukemia inhibitory factor

Keywords

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the LIF/OSM family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    202
  • Mass (Da)
    21,997
  • Last updated
    2018-03-28 v1
  • Checksum
    7974950BFF67A217
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKETIAVLAQAF

Keywords

Sequence databases

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp