A0A2J8LQ70 · A0A2J8LQ70_PANTR

Function

function

Ligand for members of the frizzled family of seven transmembrane receptors.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcell surface
Cellular Componentcytoplasm
Cellular Componentextracellular space
Molecular Functioncytokine activity
Molecular Functionfrizzled binding
Molecular Functionprotein domain specific binding
Biological Processastrocyte-dopaminergic neuron signaling
Biological Processbone development
Biological Processbranching involved in ureteric bud morphogenesis
Biological Processcanonical Wnt signaling pathway
Biological Processcell fate commitment
Biological Processcell proliferation in midbrain
Biological Processcentral nervous system morphogenesis
Biological Processcerebellum formation
Biological Processdiencephalon development
Biological Processembryonic axis specification
Biological Processembryonic brain development
Biological Processfat cell differentiation
Biological Processforebrain anterior/posterior pattern specification
Biological Processhematopoietic stem cell proliferation
Biological Processinner ear morphogenesis
Biological Processmidbrain dopaminergic neuron differentiation
Biological Processmidbrain-hindbrain boundary maturation during brain development
Biological Processmyoblast fusion
Biological Processnegative regulation of BMP signaling pathway
Biological Processnegative regulation of cell-cell adhesion
Biological Processnegative regulation of cell-substrate adhesion
Biological Processnegative regulation of cellular senescence
Biological Processnegative regulation of fat cell differentiation
Biological Processnegative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
Biological Processnegative regulation of transforming growth factor beta receptor signaling pathway
Biological Processnegative regulation of ubiquitin-dependent protein catabolic process
Biological Processneuron differentiation
Biological Processneuron fate determination
Biological Processpositive regulation of dermatome development
Biological Processpositive regulation of fibroblast proliferation
Biological Processpositive regulation of hematopoietic stem cell proliferation
Biological Processpositive regulation of insulin-like growth factor receptor signaling pathway
Biological Processpositive regulation of lamellipodium assembly
Biological Processpositive regulation of Notch signaling pathway
Biological Processpositive regulation of protein phosphorylation
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processresponse to wounding
Biological Processsignal transduction in response to DNA damage
Biological ProcessSpemann organizer formation
Biological Processspinal cord association neuron differentiation
Biological ProcessT cell differentiation in thymus

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Protein Wnt

Gene names

    • Name
      WNT1

Organism names

  • Taxonomic identifier
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Pan

Accessions

  • Primary accession
    A0A2J8LQ70
  • Secondary accessions
    • H2Q5U4

Proteomes

Organism-specific databases

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for signal, chain.

TypeIDPosition(s)Description
Signal1-27
ChainPRO_501508251528-370Protein Wnt

Keywords

Proteomic databases

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the Wnt family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    370
  • Mass (Da)
    40,982
  • Last updated
    2018-04-25 v1
  • Checksum
    F7E8111DA12E173F
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AACZ04012891
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp