A0A2I2V1W6 · A0A2I2V1W6_FELCA
- ProteinToll-like receptor 9
- GeneTLR9
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1031 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Upon CpG stimulation, induces B-cell proliferation, activation, survival and antibody production.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameToll-like receptor 9
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Feliformia > Felidae > Felinae > Felis
Accessions
- Primary accessionA0A2I2V1W6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass type I membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MGPCHGALHPLSLLVQAAALAVALA | ||||||
Chain | PRO_5016402363 | 26-1031 | Toll-like receptor 9 | |||
Sequence: QGTLPAFLPCELQRHGLVNCDWLFLKSVPHFSAAAPRGNVTSLSLYSNRIHHLHDSDFVHLSSLRRLNLKWNCPPASLSPMHFPCHMTIEPHTFLAVPTLEELNLSYNSITTVPALPSSLVSLSLSRTNILVLDPANLAGLHSLRFLFLDGNCYYKNPCPQALQVAPGALLGLGNLTHLSLKYNNLTAVPRGLPPSLEYLLLSYNHIITLAPEDLANLTALRVLDVGGNCRRCDHARNPCMECPKGFPHLHPDTFSHLNHLEGLVLKDSSLYNLNPRWFHALGNLMVLDLSENFLYDCITKTTAFQGLAQLRRLNLSFNYHKKVSFAHLHLAPSFGSLLSLQQLDMHGIFFRSLSETTLRSLVHLPMLQSLHLQMNFINQAQLSIFGAFPGLRYVDLSDNRISGAMELAAATGEVDGGERVRLPSGDLALGPPGTPSSEGFMPGCKTLNFTLDLSRNNLVTIQPEMFARLSRLQCLLLSRNSISQAVNGSQFMPLTSLQVLDLSHNKLDLYHGRSFTELPRLEALDLSYNSQPFSMQGVGHNLSFVAQLPALRYLSLAHNDIHSRVSQQLCSASLRALDFSGNALSRMWAEGDLYLRFFRGLRSLVRLDLSQNRLHTLLPRTLDNLPKSLRLLRLRDNYLAFFNWSSLVLLPRLEALDLAGNQLKALSNGSLPNGTQLQRLDLSSNSISFVASSFFALATRLRELNLSANALKTVEPSWFGSLAGTLKVLDVTGNPLHCACGAAFVDFLLEVQAAVPGLPGHVKCGSPGQLQGRSIFAQDLRLCLDEALSWDCFGLSLLTVALGLAVPMLHHLCGWDLWYCFHLCLAWLPRRGRRRGADALPYDAFVVFDKAQSAVADWVYNELRVRLEERRGRRALRLCLEERDWLPGKTLFENLWASVYSSRKMLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGTALTRDNQHFYNQNFCRGPTTAE |
Keywords
- PTM
Expression
Gene expression databases
Interaction
Subunit
Monomer and homodimer. Exists as a monomer in the absence of unmethylated cytidine-phosphate-guanosine (CpG) ligand. Proteolytic processing of an insertion loop (Z-loop) is required for homodimerization upon binding to the unmethylated CpG ligand leading to its activation. Interacts with MYD88 via their respective TIR domains. Interacts with BTK. Interacts (via transmembrane domain) with UNC93B1. Interacts with CD300LH; the interaction may promote full activation of TLR9-triggered innate responses. Interacts with CNPY3 and HSP90B1; this interaction is required for proper folding in the endoplasmic reticulum. Interacts with SMPDL3B. Interacts with CD82; this interaction is essential for TLR9-dependent myddosome formation in response to CpG stimulation.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 866-1011 | TIR | ||||
Sequence: LPYDAFVVFDKAQSAVADWVYNELRVRLEERRGRRALRLCLEERDWLPGKTLFENLWASVYSSRKMLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGTAL |
Sequence similarities
Belongs to the Toll-like receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,031
- Mass (Da)115,048
- Last updated2018-10-10 v2
- Checksum0298249B69C7B665
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AANG04000016 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |