A0A251NTR7 · A0A251NTR7_PRUPE
- ProteinKinesin-like protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids687 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | kinesin complex | |
Cellular Component | mitotic spindle astral microtubule | |
Cellular Component | mitotic spindle midzone | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | microtubule binding | |
Molecular Function | plus-end-directed microtubule motor activity | |
Biological Process | microtubule depolymerization | |
Biological Process | microtubule-based movement | |
Biological Process | mitotic sister chromatid segregation |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameKinesin-like protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Rosales > Rosaceae > Amygdaloideae > Amygdaleae > Prunus
Accessions
- Primary accessionA0A251NTR7
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-42 | |||||
Sequence: MHLIPAVLIWMSTRNAYCLSSLASLMVSMLPCLLMVLPEAEA | ||||||
Chain | PRO_5012015769 | 43-687 | Kinesin-like protein | |||
Sequence: MHLCNSVLHLDKIINWEYLSDCCGQCLEVQAQKNHNKSNSACIIGKTYTMVGTQDDPGLMVLSLHTIFDLIKRDKSSDEFEVTCSYLEVYNEVIYDLLEKSSGHLELREDPEQGVIVAGLRCIKVQSADKILELLNLGNSRRKTESTEANATSSRSHAVLEIKVKRKQKNKYRNQVMRGKLALVDLAGSERASETNSGGQKLRDGANINRSLLALANCINALGKQQKKGLAYVPYRNSKLTRILKDGLSGNSQTVMVATVSPVDSQYHHTVNTLKYADRAKEIKTHIQKNIGTIDTHVSDYQQMIDSLQIEVCRLKKELAEKESQLSVKPVEKAADDELSWLNILSHETSENVQERINLQKASFELEETNLHNRLELQHLDDAIAKEQAIGKDGEVLEVMRTRRQVILDNIRENDEAGVNYHMEIEANEKHRCQLQNMIEEAISNNGNKTYLRILSQYRLLGMANTELQFEMAMRDQVINNQREALRNMWDLLMGLGLDERQIMDLASKKGITIEDWTTTPHLGLSAREQSPDLASSKYASFGHCRGMGQSYSRSSCTFQQSQDFGSMSVPQGHLDLAHSFSREEHHSSYYLLSHDHSPSACMSMRTSSEHWFGGRSSLRFGTLDKTPQDMRKSYPVRENSSFTR |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 87-325 | Kinesin motor | ||||
Sequence: GKTYTMVGTQDDPGLMVLSLHTIFDLIKRDKSSDEFEVTCSYLEVYNEVIYDLLEKSSGHLELREDPEQGVIVAGLRCIKVQSADKILELLNLGNSRRKTESTEANATSSRSHAVLEIKVKRKQKNKYRNQVMRGKLALVDLAGSERASETNSGGQKLRDGANINRSLLALANCINALGKQQKKGLAYVPYRNSKLTRILKDGLSGNSQTVMVATVSPVDSQYHHTVNTLKYADRAKEI | ||||||
Region | 666-687 | Disordered | ||||
Sequence: LDKTPQDMRKSYPVRENSSFTR |
Sequence similarities
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length687
- Mass (Da)77,692
- Last updated2017-11-22 v1
- Checksum5090105221F46BBA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M5W4Z4 | M5W4Z4_PRUPE | PRUPE_6G211700 | 710 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM007656 EMBL· GenBank· DDBJ | ONI02638.1 EMBL· GenBank· DDBJ | Genomic DNA |