A0A221LE45 · A0A221LE45_9MURI
- ProteinV(D)J recombination-activating protein 1
- GeneRag1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids803 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T-lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities. DNA cleavage occurs in 2 steps: a first nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends: 2 hairpin coding ends and 2 blunt, 5'-phosphorylated ends.
Catalytic activity
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 divalent metal cation per subunit. Mg2+ or Mn2+.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | DNA recombinase complex | |
Cellular Component | endodeoxyribonuclease complex | |
Cellular Component | nucleus | |
Molecular Function | double-stranded DNA endonuclease activity | |
Molecular Function | histone binding | |
Molecular Function | protein homodimerization activity | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | ubiquitin protein ligase activity | |
Molecular Function | zinc ion binding | |
Biological Process | adaptive immune response | |
Biological Process | chromatin organization | |
Biological Process | pre-B cell allelic exclusion | |
Biological Process | T cell differentiation in thymus | |
Biological Process | V(D)J recombination |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameV(D)J recombination-activating protein 1
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Sundamys
Accessions
- Primary accessionA0A221LE45
Subcellular Location
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-268 | RAG1 importin-binding | ||||
Sequence: PDEIQHPHIKFSEWKFKLFRVRSFEKAPEEAQKEKDSSEGKPYLEQSPVVLDKPRGQNSVLTQRALKLHPKFSKKFHADGKSSDKAIHQARLRHFCRICGNHFKSDRHNRRYPVHGPVDAKTQSLFRKKEKRVTSWPDLIARVFQIDVKSDVDSIHPTEFCHNCWGIMHRKFSSAHSQVYCPRNVTMEWHPHTPSCDICFTAHQGLKRKRHQPNVQLSKKLKTVLNHARRDRRKRTQARVSSKEVMKKISNXSKIHLSTKLLAVDFPX | ||||||
Compositional bias | 27-41 | Basic and acidic residues | ||||
Sequence: APEEAQKEKDSSEGK | ||||||
Region | 27-56 | Disordered | ||||
Sequence: APEEAQKEKDSSEGKPYLEQSPVVLDKPRG |
Sequence similarities
Belongs to the RAG1 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length803
- Mass (Da)91,330
- Last updated2017-10-25 v1
- ChecksumE9D79DE1867FF50D
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: P | ||||||
Compositional bias | 27-41 | Basic and acidic residues | ||||
Sequence: APEEAQKEKDSSEGK | ||||||
Non-terminal residue | 803 | |||||
Sequence: K |