A0A220NV46 · A0A220NV46_9ROSI
- Protein1,4-alpha-glucan branching enzyme
- GeneSBEII
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids865 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
Pathway
Glycan biosynthesis; starch biosynthesis.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 505 | Nucleophile | ||||
Sequence: D | ||||||
Active site | 560 | Proton donor | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | amyloplast | |
Molecular Function | 1,4-alpha-glucan branching enzyme activity | |
Molecular Function | 1,4-alpha-glucan branching enzyme activity (using a glucosylated glycogenin as primer for glycogen synthesis) | |
Molecular Function | cation binding | |
Molecular Function | hydrolase activity, hydrolyzing O-glycosyl compounds | |
Biological Process | glycogen biosynthetic process | |
Biological Process | starch biosynthetic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name1,4-alpha-glucan branching enzyme
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fagales > Fagaceae > Castanea
Accessions
- Primary accessionA0A220NV46
Subcellular Location
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 72-88 | Polar residues | ||||
Sequence: SQGDGSLSLTDQLDNPE | ||||||
Region | 72-106 | Disordered | ||||
Sequence: SQGDGSLSLTDQLDNPETVLKDPQGLHDVDNQTME | ||||||
Region | 125-150 | Disordered | ||||
Sequence: NEVQHEQESAASSLVGDDSRAQGKKP | ||||||
Domain | 362-722 | Glycosyl hydrolase family 13 catalytic | ||||
Sequence: NTYANFRDDVLPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRCGTPDDLKSLIDKAHELGLLVLMDIVHSHASNNVLDGLNLLDGTDSHYFHSGSRGYHWMWDSRLFNYGSWEVIRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVAFTGNYTEYFGLATDVDAVVYLMLVNDVIHGLFPEAVSIGEDVSGMPAFCIPVQDGGVGFDYRLHMAIADKWIELLKKKDEDWRMGDIVHTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGDQHLPDGRIILGNNNSYDKCR |
Sequence similarities
Belongs to the glycosyl hydrolase 13 family. GlgB subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length865
- Mass (Da)98,761
- Last updated2017-10-25 v1
- Checksum0ED4956BF90215F0
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 72-88 | Polar residues | ||||
Sequence: SQGDGSLSLTDQLDNPE |