A0A219YHF9 · A0A219YHF9_BPK54
- ProteinDNA-directed DNA polymerase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids705 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Replicates viral genomic DNA. This polymerase possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction.
Catalytic activity
- a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 5 | Mg2+ 2 (UniProtKB | ChEBI); catalytic; for 3'-5' exonuclease activity | ||||
Sequence: D | ||||||
Binding site | 5 | Mg2+ 1 (UniProtKB | ChEBI); catalytic; for 3'-5' exonuclease activity | ||||
Sequence: D | ||||||
Binding site | 7 | Mg2+ 2 (UniProtKB | ChEBI); catalytic; for 3'-5' exonuclease activity | ||||
Sequence: E | ||||||
Binding site | 174 | Mg2+ 2 (UniProtKB | ChEBI); catalytic; for 3'-5' exonuclease activity | ||||
Sequence: D | ||||||
Binding site | 476 | Mg2+ 4 (UniProtKB | ChEBI); catalytic; for polymerase activity | ||||
Sequence: D | ||||||
Binding site | 476 | Mg2+ 3 (UniProtKB | ChEBI); catalytic; for polymerase activity | ||||
Sequence: D | ||||||
Binding site | 477 | Mg2+ 4 (UniProtKB | ChEBI); catalytic; for polymerase activity | ||||
Sequence: A | ||||||
Binding site | 507 | substrate | ||||
Sequence: H | ||||||
Binding site | 519 | substrate | ||||
Sequence: R | ||||||
Binding site | 523 | substrate | ||||
Sequence: K | ||||||
Binding site | 527 | substrate | ||||
Sequence: Y | ||||||
Binding site | 655 | Mg2+ 4 (UniProtKB | ChEBI); catalytic; for polymerase activity | ||||
Sequence: D | ||||||
Binding site | 655 | Mg2+ 3 (UniProtKB | ChEBI); catalytic; for polymerase activity | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | 3'-5' exonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed DNA polymerase activity | |
Molecular Function | metal ion binding | |
Molecular Function | nucleotide binding | |
Biological Process | DNA-templated DNA replication | |
Biological Process | double-strand break repair | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA-directed DNA polymerase
- EC number
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Przondovirus > Przondovirus K54
- Virus hosts
Accessions
- Primary accessionA0A219YHF9
Proteomes
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-187 | 3'-5'exonuclease | ||||
Sequence: MLVTDIEANNLLEKVTQFHCGVIYDYSTDEYVSYRPWDFSAYLDALEAEVARGGLIVFHNGHKYDAPVLTKLAKLQLNREFHLPRENVVDTLVLSRLLFANIKDSDMALLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKKLLEEQGEDYVDGAEWISFNEPMMAYNVQDVVVTKALLEKLLS | ||||||
Region | 203-705 | Polymerase | ||||
Sequence: DAVSFWDNSCEAVWLEHRAAWLLAKQERNGFPFNTKAIEELYVELAGRRSELLQTLTDTFGTWYQPKGGTELFLHPRTGKPLGKYPRVKYPKQGAIYKKPKNKAQREGREPCELDTRDYVEGAPYTPVEHVVFNPSSRDHIALKLKEAGWVPTEFTDKGAPKVDDEVLEHVRVEDPEKQRCIDLIKEYLMIQKRIGQAAEGDKAWLRYVQEDGKIHGSVNPNGAVTGRATHSFPNLGQVPGVRSPYGEPCRAAFGAEHHLDGLTGLPWVQAGIDASGLELRCLAHFMSKYDGGAYADVILNGDIHTVNQHAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALREGIQQTLVESSRWVAGEQKVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIVETEELLLKAGLKHGWDGDFAYMAWVHDEIQVACRTPEIAQQVIDTAQQAMRNVGEHFKFRCRLDTEGKMGPNWAVCH | ||||||
Domain | 449-665 | DNA-directed DNA polymerase family A palm | ||||
Sequence: GEPCRAAFGAEHHLDGLTGLPWVQAGIDASGLELRCLAHFMSKYDGGAYADVILNGDIHTVNQHAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALREGIQQTLVESSRWVAGEQKVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIVETEELLLKAGLKHGWDGDFAYMAWVHDEIQVACRTPE |
Sequence similarities
Belongs to the DNA polymerase type-A family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length705
- Mass (Da)79,734
- Last updated2017-10-25 v1
- ChecksumCD6D0FFB530666EA