A0A1X9PY88 · ERN1_LOTJA
- ProteinEthylene-responsive transcription factor ERN1
- GeneERN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids269 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Transcription factor involved in the symbiotic nodule signaling pathway in response to rhizobial stimulation. Functions as a transcriptional regulator required for root infection by symbiotic rhizobia, infection thread (IT) formation, and nodule development. May coordinate these processes (PubMed:28028038, PubMed:28068194, PubMed:28503742).
Functions downstream of the CCAMK-CYCLOPS complex (PubMed:28028038, PubMed:28503742).
Probably not involved in arbuscular mycorrhizal (AM) symbiosis (PubMed:28068194).
Functions downstream of the CCAMK-CYCLOPS complex (PubMed:28028038, PubMed:28503742).
Probably not involved in arbuscular mycorrhizal (AM) symbiosis (PubMed:28068194).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 34-91 | AP2/ERF | ||||
Sequence: KFVGVRQRPSGRWVAEIKDTTQKIRMWLGTFETAEEAARAYDEAACLLRGSNTRTNFI |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | nodulation | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEthylene-responsive transcription factor ERN1
- Short namesERF transcription factor ERN1
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > robinioid clade > Loteae > Lotus
Accessions
- Primary accessionA0A1X9PY88
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions, but roots of mutant plants are impaired in the interaction with rhizobia, formation of infection threads (ITs) and nodule development.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444706 | 1-269 | Ethylene-responsive transcription factor ERN1 | |||
Sequence: MEIQFQQPNLQQHQKAGTKGGKFKGRNRNSNTNKFVGVRQRPSGRWVAEIKDTTQKIRMWLGTFETAEEAARAYDEAACLLRGSNTRTNFITHVSLDSPLASRIRNLLNNKKGNKKQEGVVDVGVDVDVPAPSASTTSTSSNTSNSDKNDHNSLSSGKVQNTMLFDDAYKPDLSNCKEDFQSCPPQSNFSWGFGPVFDRFPIAQILDMPKTDGMIDAASLELSEFERMKVERQISASLYAINGVHEYMETVQDSNETLWDLPPLCSLFC |
Expression
Induction
Induced in nodules 7 days after rhizobial inoculation.
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MEIQFQQPNLQQHQKA | ||||||
Region | 1-36 | Disordered | ||||
Sequence: MEIQFQQPNLQQHQKAGTKGGKFKGRNRNSNTNKFV | ||||||
Region | 128-157 | Disordered | ||||
Sequence: DVPAPSASTTSTSSNTSNSDKNDHNSLSSG | ||||||
Compositional bias | 131-157 | Polar residues | ||||
Sequence: APSASTTSTSSNTSNSDKNDHNSLSSG |
Sequence similarities
Belongs to the AP2/ERF transcription factor family. ERF subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length269
- Mass (Da)30,025
- Last updated2017-08-30 v1
- Checksum035C21727F0A52D3
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MEIQFQQPNLQQHQKA | ||||||
Compositional bias | 131-157 | Polar residues | ||||
Sequence: APSASTTSTSSNTSNSDKNDHNSLSSG |