A0A1X2A713 · A0A1X2A713_9MYCO
- ProteinIsopentenyl-diphosphate delta-isomerase
- Genefni
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids348 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in the biosynthesis of isoprenoids. Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its allylic isomer, dimethylallyl diphosphate (DMAPP).
Catalytic activity
- isopentenyl diphosphate = dimethylallyl diphosphate
Cofactor
Protein has several cofactor binding sites:
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11-12 | substrate | ||||
Sequence: RK | ||||||
Binding site | 70-72 | FMN (UniProtKB | ChEBI) | ||||
Sequence: AMT | ||||||
Binding site | 100 | FMN (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 100-102 | substrate | ||||
Sequence: SQR | ||||||
Binding site | 131 | FMN (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 165 | substrate | ||||
Sequence: Q | ||||||
Binding site | 166 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 197 | FMN (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 231 | FMN (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 278-280 | FMN (UniProtKB | ChEBI) | ||||
Sequence: GIR | ||||||
Binding site | 299-300 | FMN (UniProtKB | ChEBI) | ||||
Sequence: AR |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | FMN binding | |
Molecular Function | isopentenyl-diphosphate delta-isomerase activity | |
Molecular Function | magnesium ion binding | |
Molecular Function | NADPH binding | |
Molecular Function | oxidoreductase activity | |
Biological Process | isoprenoid biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameIsopentenyl-diphosphate delta-isomerase
- EC number
- Short namesIPP isomerase
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Mycobacteriales > Mycobacteriaceae > Mycobacterium > Mycobacterium simiae complex
Accessions
- Primary accessionA0A1X2A713
Proteomes
Subcellular Location
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 251-340 | FMN-dependent dehydrogenase | ||||
Sequence: ADWGIPTAQAIGEVRAALPDIPLVASGGIRTGMDAAKALALGADVVAVARPLLPAAIESAEAATAWLQRFVDELRICLHGCGAADLRALR |
Sequence similarities
Belongs to the IPP isomerase type 2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length348
- Mass (Da)36,452
- Last updated2017-07-05 v1
- Checksum9C49F18A83621BE1