A0A1W2PPJ7 · A0A1W2PPJ7_HUMAN
- ProteinCofactor required for Sp1 transcriptional activation subunit 6
- GeneMED17
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mediator complex | |
Molecular Function | transcription coregulator activity | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCofactor required for Sp1 transcriptional activation subunit 6
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A1W2PPJ7
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 48-85 | Disordered | ||||
Sequence: DFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEVS |
Sequence similarities
Belongs to the Mediator complex subunit 17 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length85
- Mass (Da)9,000
- Last updated2017-06-07 v1
- ChecksumEBC0032E0B754781
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9NVC6 | MED17_HUMAN | MED17 | 651 | ||
A0A1W2PPP8 | A0A1W2PPP8_HUMAN | MED17 | 233 | ||
A0A1W2PQ48 | A0A1W2PQ48_HUMAN | MED17 | 386 | ||
A0A1W2PPC8 | A0A1W2PPC8_HUMAN | MED17 | 123 | ||
A0A1W2PNW7 | A0A1W2PNW7_HUMAN | MED17 | 605 | ||
A0A1W2PNF3 | A0A1W2PNF3_HUMAN | MED17 | 185 | ||
A0A1W2PR99 | A0A1W2PR99_HUMAN | MED17 | 287 | ||
A0A1W2PQE4 | A0A1W2PQE4_HUMAN | MED17 | 219 | ||
A0A1W2PRS0 | A0A1W2PRS0_HUMAN | MED17 | 48 | ||
A0A1W2PRX4 | A0A1W2PRX4_HUMAN | MED17 | 530 | ||
A0A1W2PS69 | A0A1W2PS69_HUMAN | MED17 | 500 | ||
A0A1W2PS27 | A0A1W2PS27_HUMAN | MED17 | 652 | ||
E9PM72 | E9PM72_HUMAN | MED17 | 509 | ||
E9PJZ4 | E9PJZ4_HUMAN | MED17 | 72 | ||
E9PKQ4 | E9PKQ4_HUMAN | MED17 | 231 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP001894 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |