A0A1W2PPB6 · A0A1W2PPB6_HUMAN
- ProteinGPI ethanolamine phosphate transferase 1
- GenePIGN
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids738 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the first alpha-1,4-linked mannose of the glycosylphosphatidylinositol precursor of GPI-anchor.
Pathway
Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | mannose-ethanolamine phosphotransferase activity | |
Biological Process | GPI anchor biosynthetic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGPI ethanolamine phosphate transferase 1
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A1W2PPB6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 441-463 | Helical | ||||
Sequence: FFLGVNVVIGFVGWISYASLLII | ||||||
Transmembrane | 483-500 | Helical | ||||
Sequence: LLPCSFVAIGILVAFFLL | ||||||
Transmembrane | 506-523 | Helical | ||||
Sequence: WTYYVYGLLPLPIWYAVL | ||||||
Transmembrane | 532-551 | Helical | ||||
Sequence: LVVSVLTYPLSHFVGYLLAF | ||||||
Transmembrane | 563-581 | Helical | ||||
Sequence: FYRYMLTAGLTAFAAWPFL | ||||||
Transmembrane | 593-611 | Helical | ||||
Sequence: LSWTFFSLLLAVFPLMPVV | ||||||
Transmembrane | 617-638 | Helical | ||||
Sequence: ISLVMGAGLLVLLLSLCVVTSL | ||||||
Transmembrane | 650-668 | Helical | ||||
Sequence: LLVHLLQVLSTVLSMYVVY | ||||||
Transmembrane | 680-701 | Helical | ||||
Sequence: LPLMNQIISWATLASSLVVPLL | ||||||
Transmembrane | 713-737 | Helical | ||||
Sequence: ILLSLMSTYLLLSTGSPVSSSLIIL |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 800 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 430-727 | GPI ethanolamine phosphate transferase 1 C-terminal | ||||
Sequence: KGLSYYHTYDRFFLGVNVVIGFVGWISYASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTYYVYGLLPLPIWYAVLREFQVIQDLVVSVLTYPLSHFVGYLLAFTLGIEVLVLSFFYRYMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLLSLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMYVVYSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMSTYLLLSTG |
Sequence similarities
Belongs to the PIGG/PIGN/PIGO family. PIGN subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length738
- Mass (Da)83,562
- Last updated2017-06-07 v1
- ChecksumD0786449DD579012
Computationally mapped potential isoform sequences
There are 26 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O95427 | PIGN_HUMAN | PIGN | 931 | ||
K7EID9 | K7EID9_HUMAN | PIGN | 140 | ||
A0A1W2PPR7 | A0A1W2PPR7_HUMAN | PIGN | 797 | ||
A0A1W2PQ49 | A0A1W2PQ49_HUMAN | PIGN | 184 | ||
A0A1W2PPK6 | A0A1W2PPK6_HUMAN | PIGN | 246 | ||
A0A1W2PPA0 | A0A1W2PPA0_HUMAN | PIGN | 525 | ||
A0A1W2PNW5 | A0A1W2PNW5_HUMAN | PIGN | 621 | ||
A0A1W2PNQ8 | A0A1W2PNQ8_HUMAN | PIGN | 847 | ||
A0A1W2PNR0 | A0A1W2PNR0_HUMAN | PIGN | 897 | ||
A0A1W2PNH8 | A0A1W2PNH8_HUMAN | PIGN | 911 | ||
A0A1W2PQZ1 | A0A1W2PQZ1_HUMAN | PIGN | 798 | ||
A0A1W2PQR8 | A0A1W2PQR8_HUMAN | PIGN | 854 | ||
A0A1W2PR74 | A0A1W2PR74_HUMAN | PIGN | 751 | ||
A0A1W2PQP4 | A0A1W2PQP4_HUMAN | PIGN | 870 | ||
A0A1W2PQA9 | A0A1W2PQA9_HUMAN | PIGN | 970 | ||
A0A1W2PS19 | A0A1W2PS19_HUMAN | PIGN | 936 | ||
A0A1W2PRH3 | A0A1W2PRH3_HUMAN | PIGN | 375 | ||
K7EJM6 | K7EJM6_HUMAN | PIGN | 143 | ||
K7ELE1 | K7ELE1_HUMAN | PIGN | 490 | ||
K7EL34 | K7EL34_HUMAN | PIGN | 283 | ||
K7EMD7 | K7EMD7_HUMAN | PIGN | 395 | ||
K7ENK2 | K7ENK2_HUMAN | PIGN | 70 | ||
K7EPJ2 | K7EPJ2_HUMAN | PIGN | 391 | ||
K7EQG0 | K7EQG0_HUMAN | PIGN | 138 | ||
K7ERX5 | K7ERX5_HUMAN | PIGN | 83 | ||
K7ESH9 | K7ESH9_HUMAN | PIGN | 198 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC090354 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC090396 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC105183 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
FP340563 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF456430 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |