A0A1W2FW33 · A0A1W2FW33_KIBAR
- ProteinAcyl transferase domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids2813 (go to sequence)
- Protein existencePredicted
- Annotation score5/5
Function
function
Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic activities and a site for the binding of the prosthetic group 4'-phosphopantetheine of the acyl carrier protein ([ACP]) domain.
Catalytic activity
- (2E)-butenoyl-[ACP] + NADPH + H+ = butanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-decenoyl-[ACP] + NADPH + H+ = decanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-dodecenoyl-[ACP] + NADPH + H+ = dodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexadecenoyl-[ACP] + NADPH + H+ = hexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexenoyl-[ACP] + NADPH + H+ = hexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-octadecenoyl-[ACP] + NADPH + H+ = octadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-octenoyl-[ACP] + NADPH + H+ = octanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-tetradecenoyl-[ACP] + NADPH + H+ = tetradecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (3R)-hydroxybutanoyl-[ACP] = (2E)-butenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydecanoyl-[ACP] = (2E)-decenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydodecanoyl-[ACP] = (2E)-dodecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexadecanoyl-[ACP] = (2E)-hexadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexanoyl-[ACP] = (2E)-hexenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctadecanoyl-[ACP] = (2E)-octadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctanoyl-[ACP] = (2E)-octenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxytetradecanoyl-[ACP] = (2E)-tetradecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- 3-oxobutanoyl-[ACP] + NADPH + H+ = (3R)-hydroxybutanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxodecanoyl-[ACP] + NADPH + H+ = (3R)-hydroxydecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxododecanoyl-[ACP] + NADPH + H+ = (3R)-hydroxydodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexadecanoyl-[ACP] + NADPH + H+ = (3R)-hydroxyhexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexanoyl-[ACP] + NADPH + H+ = (3R)-hydroxyhexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctadecanoyl-[ACP] + NADPH + H+ = (3R)-hydroxyoctadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctanoyl-[ACP] + NADPH + H+ = (3R)-hydroxyoctanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxotetradecanoyl-[ACP] + NADPH + H+ = (3R)-hydroxytetradecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- hexadecanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxooctadecanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- hexanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxooctanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- octanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxodecanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- tetradecanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxohexadecanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- acetyl-[ACP] + malonyl-[ACP] + H+ = 3-oxobutanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- butanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxohexanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- decanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxododecanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
- dodecanoyl-[ACP] + malonyl-[ACP] + H+ = 3-oxotetradecanoyl-[ACP] + holo-[ACP] + CO2This reaction proceeds in the forward direction.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 943 | Proton acceptor; for dehydratase activity | ||||
Sequence: H | ||||||
Active site | 1107 | Proton donor; for dehydratase activity | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | (3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity | |
Molecular Function | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity | |
Molecular Function | 3-oxoacyl-[acyl-carrier-protein] synthase activity | |
Molecular Function | [acyl-carrier-protein] S-acetyltransferase activity | |
Molecular Function | enoyl-[acyl-carrier-protein] reductase (NADPH) activity | |
Molecular Function | fatty acid synthase activity | |
Molecular Function | fatty acyl-[ACP] hydrolase activity | |
Molecular Function | phosphopantetheine binding | |
Biological Process | antibiotic biosynthetic process | |
Biological Process | fatty acid biosynthetic process | |
Biological Process | polyketide biosynthetic process | |
Biological Process | toxin biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Pseudonocardiales > Pseudonocardiaceae > Kibdelosporangium
Accessions
- Primary accessionA0A1W2FW33
Proteomes
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-442 | Ketosynthase family 3 (KS3) | ||||
Sequence: HEGIAVVGIGCRFPGHVSSADDLWRLLLDERDAVQAVPKDRWTGAAFYDHDASRPGHLRTQAGGYVDDVAAFDAHFFGIAPTEAARMDPQQRLFLETTWEALQDAGIVPELLAGTKTAVYAGVSGHDYGIIQLNPENRYLLGGHTMAGVTNCIVANRVSYLLDLRGPSMIVDTACSSSLVAIHLACRSIRSGEATMAIAGGVGALLIPETTIAFSQGTFLSPEGRSKSFSKSADGYVRSEGSGTVVLKPLSAAVADGDRIYAVIRGTATNSDGRTNGISVPSEEAQAQMILDACRDAGVAPTSIGYIEAHGTGTSVGDPIEARALGKALGSGRNGQGPCIVGAVKSNMGHLEPAAGIAGMIKACLVVSKGEIPANIHAEEPNPAIPFEELGLRLATARQPWPGDGPRLAGVNSFGFGGSNAHVILEG | ||||||
Region | 910-1032 | N-terminal hotdog fold | ||||
Sequence: HPLVGTENRAADEPGKRVWELVLDPIRFPWLDDHRVQGPIVFPAAAYLDMVFGCAQDAFGDGPFSLEDVEFRRALFVFDDRPAPVVQVVLTQAMHFSVYSRQDSDAEWTLHSVGTLRRGAPTT | ||||||
Domain | 910-1198 | PKS/mFAS DH | ||||
Sequence: HPLVGTENRAADEPGKRVWELVLDPIRFPWLDDHRVQGPIVFPAAAYLDMVFGCAQDAFGDGPFSLEDVEFRRALFVFDDRPAPVVQVVLTQAMHFSVYSRQDSDAEWTLHSVGTLRRGAPTTALPKPISELQAECPVEIDPAELYAVLGRNGLALGPTFRAAVQFWRSDRKCLAQLETPAASADEAPRHAIHPGVLDSCITTLPVAYGDVLTGDVVNHQAKMLYLPVEVKRLSFHTRPSGRLFVYAQAHATDDPMFSSGDFWIVDEDGTIVAEFDGLKFKSITRSADD | ||||||
Region | 1046-1198 | C-terminal hotdog fold | ||||
Sequence: PVEIDPAELYAVLGRNGLALGPTFRAAVQFWRSDRKCLAQLETPAASADEAPRHAIHPGVLDSCITTLPVAYGDVLTGDVVNHQAKMLYLPVEVKRLSFHTRPSGRLFVYAQAHATDDPMFSSGDFWIVDEDGTIVAEFDGLKFKSITRSADD | ||||||
Domain | 2455-2532 | Carrier | ||||
Sequence: AREPRLVAALSEQIARIFDMPVERLAHDVALTDLGMDSLMAGQIRNALAKHLEIDFPTMGLMRGPTVVELTKEVLGQV |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,813
- Mass (Da)305,993
- Last updated2017-06-07 v1
- ChecksumD38950F8D5B0E3FB
Keywords
- Technical term