A0A1S7IVR9 · A0A1S7IVR9_9GOBI
- ProteinType-1 angiotensin II receptor
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids364 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Receptor for angiotensin II, a vasoconstricting peptide, which acts as a key regulator of blood pressure and sodium retention by the kidney. The activated receptor in turn couples to G-alpha proteins G(q) and thus activates phospholipase C and increases the cytosolic Ca2+ concentrations, which in turn triggers cellular responses such as stimulation of protein kinase C.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Molecular Function | angiotensin type I receptor activity | |
Molecular Function | angiotensin type II receptor activity | |
Molecular Function | C-C chemokine binding | |
Molecular Function | C-C chemokine receptor activity | |
Biological Process | brain development | |
Biological Process | calcium-mediated signaling | |
Biological Process | cell chemotaxis | |
Biological Process | immune response | |
Biological Process | neurogenesis | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | regulation of vasoconstriction |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameType-1 angiotensin II receptor
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Gobiaria > Gobiiformes > Gobioidei > Gobiidae > Oxudercinae > Periophthalmus
Accessions
- Primary accessionA0A1S7IVR9
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 32-55 | Helical | ||||
Sequence: IVYGCNFIIGLVGNSMVVAVIYCY | ||||||
Transmembrane | 62-83 | Helical | ||||
Sequence: AHIFVLNLAISDLTFLITLPMW | ||||||
Transmembrane | 95-121 | Helical | ||||
Sequence: FGGFLCKATAALASFNLYTSIFFLTAL | ||||||
Transmembrane | 142-164 | Helical | ||||
Sequence: LYARITCVLIWLFALLLSVPIAL | ||||||
Transmembrane | 195-222 | Helical | ||||
Sequence: VLLAISLMKSLLGFLLPFIIIITCYCLI | ||||||
Transmembrane | 243-264 | Helical | ||||
Sequence: VLRMLAAAVLAFFVCWVPHQIF | ||||||
Transmembrane | 284-310 | Helical | ||||
Sequence: IIDTVMPFTICIAYFNSCVNPIVYGFV |
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 44-307 | G-protein coupled receptors family 1 profile | ||||
Sequence: GNSMVVAVIYCYMKLKTVAHIFVLNLAISDLTFLITLPMWATMTATGYHWPFGGFLCKATAALASFNLYTSIFFLTALSIDRYLAIVHPVSSRRFRTVLYARITCVLIWLFALLLSVPIALTRDIHNINNRNLTVCAILHPTKDNVQSLEQVLLAISLMKSLLGFLLPFIIIITCYCLIGRALLGARHIQKSSQSRDDEVLRMLAAAVLAFFVCWVPHQIFHFMQLLTQLSKTDNCRLLEIIDTVMPFTICIAYFNSCVNPIVY |
Sequence similarities
Belongs to the G-protein coupled receptor 1 family.
Keywords
- Domain
Family and domain databases
Protein family/group databases
Sequence
- Sequence statusComplete
- Length364
- Mass (Da)40,473
- Last updated2017-05-10 v1
- Checksum3029536CE7C15EA8