A0A1P8D6Q1 · A0A1P8D6Q1_9FLOR
- ProteinCytochrome c6
- GenepetJ
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids108 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Functions as an electron carrier between membrane-bound cytochrome b6-f and photosystem I in oxygenic photosynthesis.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 37 | heme c (UniProtKB | ChEBI); covalent | ||||
Sequence: C | ||||||
Binding site | 40 | heme c (UniProtKB | ChEBI); covalent | ||||
Sequence: C | ||||||
Binding site | 41 | Fe (UniProtKB | ChEBI) of heme c (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 81 | Fe (UniProtKB | ChEBI) of heme c (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: M |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid lumen | |
Molecular Function | electron transfer activity | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Biological Process | photosynthesis |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome c6
- Alternative names
Gene names
Encoded on
- Plastid
Organism names
- Organism
- Taxonomic lineageEukaryota > Rhodophyta > Florideophyceae > Rhodymeniophycidae > Gracilariales > Gracilariaceae > Gracilaria
Accessions
- Primary accessionA0A1P8D6Q1
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MRLLFTFFIILNIFTYKVQA | ||||||
Chain | PRO_5013414442 | 21-108 | Cytochrome c6 | |||
Sequence: TFAADLDAGEQIFSANCAACHANGNNAIMPDKTLKSDALSENSMNSIEAITNQVKNGKNAMPAFGGRLADEDIENVANYVLSKSENGW |
Post-translational modification
Binds 1 heme c group per subunit.
Interaction
Subunit
Monomer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-104 | Cytochrome c | ||||
Sequence: ADLDAGEQIFSANCAACHANGNNAIMPDKTLKSDALSENSMNSIEAITNQVKNGKNAMPAFGGRLADEDIENVANYVLSKS |
Sequence similarities
Belongs to the cytochrome c family. PetJ subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length108
- Mass (Da)11,768
- Last updated2017-04-12 v1
- Checksum2C6A167D21E164E9