A0A1P8AUL5 · A0A1P8AUL5_ARATH
- Proteinnon-specific serine/threonine protein kinase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1001 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | ATP binding | |
Molecular Function | protein kinase activity | |
Molecular Function | protein serine/threonine kinase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namenon-specific serine/threonine protein kinase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A1P8AUL5
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-35 | |||||
Sequence: MSAAYNLMIKSKSCLFSSSILFVVTLIYLLCTVSA | ||||||
Chain | PRO_5010187859 | 36-1001 | non-specific serine/threonine protein kinase | |||
Sequence: SPSLHPDEVEALKDITETLGVKHLNLSEDPCLTKTLVISQGVLKEGQNSTIRCDCHFNNYSTCHIKHFVLQKFNLPGRLPPMLYKFRHLESIDLYNNYLYGSIPMEWASLPYLKSISVCANRLSGDIPKGLGKFINLTLLVLEANQFSGTIPKELGNLVNLQGLGLSSNQLVGGLPKTLAKLTKLTNLHLSDNRLNGSIPEFIGKLPKLQRLELYASGLRGPIPDSIFHLENLIDVRISDTVAGLGHVPQITSTSLKYLVLRNINLSGPIPTSIWDLPSLMTLDLSFNRLTGEIPAYATAPKYTYLAGNMLSGKVETGAFLTASTNIDLSYNNFTWSPMCKERKNINTYESSHSKNRLTRLLPCSAIKQCQNYSRSLHINCGGPDVTIENSRGRFLYEGDNYGLTGSATNYYRKNWGYSNTGDFMDDAITEDTYTVSSESAVSAKYPDLYQNARRSPLSLAYYAFCFENGSYNVKLHFAEIQFSDVEPYTKLAKRVFNIYIQGKLIWEDFSIREEANGTHKEVIREVNTTVTDNTLEIRLYWAGKGTMIIPQRGYYGSLISAVSVCPSSESECGVPVQFLPVKKDHKPTKYPLILGLTLSLAFLLLAAFCWRKCVSNANAAERGSFSLRQLKVATNDFDPLNKIGEGGFGSVYKGRLPDGTLIAVKKLSSKSHQGNKEFVNEIGMIACLQHPNLVKLYGCCVEKNQLLLVYEYLENNCLSDALFGRSCLKLEWGTRHKICLGIARGLAFLHEDSAVKIIHRDIKGTNVLLDKDLNSKISDFGLARLHEDNQSHITTRVAGTIGYMAPEYAMRGHLTEKADVYSFGVVAMEIVSGKSNAKYTPDDECCVGLLDWAFVLQKKGDIAEILDPRLEGMFDVMEAERMIKVSLLCANKSSTLRPNMSQVVKMLEGETEIEQIISDPGVYSDNLHFKPSSLSSDYILSIPSSSESAYDLYPLSPESIVFTIQ |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 673-949 | Protein kinase | ||||
Sequence: FDPLNKIGEGGFGSVYKGRLPDGTLIAVKKLSSKSHQGNKEFVNEIGMIACLQHPNLVKLYGCCVEKNQLLLVYEYLENNCLSDALFGRSCLKLEWGTRHKICLGIARGLAFLHEDSAVKIIHRDIKGTNVLLDKDLNSKISDFGLARLHEDNQSHITTRVAGTIGYMAPEYAMRGHLTEKADVYSFGVVAMEIVSGKSNAKYTPDDECCVGLLDWAFVLQKKGDIAEILDPRLEGMFDVMEAERMIKVSLLCANKSSTLRPNMSQVVKMLEGETEI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,001
- Mass (Da)111,287
- Last updated2017-04-12 v1
- Checksum882FFD2D24846643
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F4I336 | F4I336_ARATH | At1g29730 | 969 | ||
A0A1P8AUP1 | A0A1P8AUP1_ARATH | At1g29730 | 947 | ||
A0A1P8AUL0 | A0A1P8AUL0_ARATH | At1g29730 | 915 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP002684 EMBL· GenBank· DDBJ | ANM60338.1 EMBL· GenBank· DDBJ | Genomic DNA |