A0A1I9LMB4 · A0A1I9LMB4_ARATH
- ProteinChlorophyll a-b binding protein, chloroplastic
- GeneLHCB23
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids298 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 90 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: Y | ||||||
Binding site | 112 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 118 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 131 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 134 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 136 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: R | ||||||
Binding site | 169 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 179 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 189 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: S | ||||||
Binding site | 197 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: Q | ||||||
Binding site | 205 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: E | ||||||
Binding site | 214 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: L | ||||||
Binding site | 245 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 246 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 249 | Mg (UniProtKB | ChEBI) of chlorophyll a 6 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: N | ||||||
Binding site | 251 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 263 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 278 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 287 | chlorophyll a 1 (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 294 | Mg (UniProtKB | ChEBI) of chlorophyll b 1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: F |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem I | |
Cellular Component | photosystem II | |
Molecular Function | chlorophyll binding | |
Biological Process | photosynthesis, light harvesting |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameChlorophyll a-b binding protein, chloroplastic
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A1I9LMB4
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-34 | |||||
Sequence: MNTLLYKRRLQFNNISFSLTSFLFLCSCLEEAMA | ||||||
Chain | PRO_5009605490 | 35-298 | Chlorophyll a-b binding protein, chloroplastic | |||
Sequence: TSAIQHSSFAGQTTLKPSNDLLRKIGASNGGGRIIMRRTVKSTPQSIWYGPDRPKYLGPFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANNAWAYATNFVPGK |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length298
- Mass (Da)32,588
- Last updated2017-02-15 v1
- ChecksumBC07FE61AC35B969
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9XF87 | CB24_ARATH | LHCB2.4 | 266 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP002686 EMBL· GenBank· DDBJ | ANM63722.1 EMBL· GenBank· DDBJ | Genomic DNA |