A0A1I7P7Q0 · A0A1I7P7Q0_9INFA
- ProteinPolymerase basic protein 2
- GenePB2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids759 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Plays an essential role in transcription initiation and cap-stealing mechanism, in which cellular capped pre-mRNAs are used to generate primers for viral transcription. Recognizes and binds the 7-methylguanosine-containing cap of the target pre-RNA which is subsequently cleaved after 10-13 nucleotides by the viral protein PA. Plays a role in the initiation of the viral genome replication and modulates the activity of the ribonucleoprotein (RNP) complex.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 627 | Avian adaptation | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell mitochondrion | |
Cellular Component | host cell nucleus | |
Cellular Component | virion component | |
Molecular Function | RNA binding | |
Molecular Function | RNA-dependent RNA polymerase activity | |
Biological Process | 7-methylguanosine mRNA capping | |
Biological Process | cap snatching | |
Biological Process | DNA-templated transcription | |
Biological Process | symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity | |
Biological Process | viral RNA genome replication |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePolymerase basic protein 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Polyploviricotina > Insthoviricetes > Articulavirales > Orthomyxoviridae > Alphainfluenzavirus > Alphainfluenzavirus influenzae > Influenza A virus
Accessions
- Primary accessionA0A1I7P7Q0
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Interaction
Subunit
Influenza RNA polymerase is composed of three subunits: PB1, PB2 and PA. Interacts (via N-terminus) with PB1 (via C-terminus). Interacts with nucleoprotein NP (via N-terminus).
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-36 | Influenza RNA polymerase PB2 N-terminal region | ||||
Sequence: MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTS | ||||||
Domain | 37-104 | Influenza RNA polymerase PB2 second | ||||
Sequence: GRQEKNPALRMKWMMAMKYPITADKRIMDIIPERNEQGQTLWSKTNDAGSDRVMVSPLAITWWNRNGP | ||||||
Domain | 107-248 | Influenza RNA polymerase PB2 middle | ||||
Sequence: STVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQNCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGG | ||||||
Domain | 250-319 | Polymerase basic protein 2 helical | ||||
Sequence: VRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVKMVDILRQNPTEEQAVDICKAAIGLRI | ||||||
Domain | 320-530 | Influenza RNA polymerase PB2 CAP binding | ||||
Sequence: SSSFSFGGFTFKRTSGSSVKKEEEMLTGNLQTLKLRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTIT | ||||||
Domain | 531-680 | Influenza RNA polymerase PB2 sixth | ||||
Sequence: YSSSMMWEINGPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPD | ||||||
Domain | 683-757 | Influenza RNA polymerase PB2 C-terminal | ||||
Sequence: TSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMA | ||||||
Motif | 736-739 | Nuclear localization signal | ||||
Sequence: KRKR |
Sequence similarities
Belongs to the influenza viruses PB2 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length759
- Mass (Da)85,847
- Last updated2017-01-18 v1
- Checksum86C1BA4F046933C9