A0A1I5Q3Q8 · A0A1I5Q3Q8_9EURY
- ProteinProbable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids548 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. The Kae1 domain likely plays a direct catalytic role in this reaction. The Bud32 domain probably displays kinase activity that regulates Kae1 function.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Note: Binds 1 Fe2+ ion per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 105 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 109 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 126-130 | L-threonylcarbamoyladenylate (UniProtKB | ChEBI) | ||||
Sequence: NASGA | ||||||
Binding site | 158 | L-threonylcarbamoyladenylate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 171 | L-threonylcarbamoyladenylate (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 175 | L-threonylcarbamoyladenylate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 271 | L-threonylcarbamoyladenylate (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 299 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 362-370 | ATP (UniProtKB | ChEBI) | ||||
Sequence: PRRGAEAVV | ||||||
Binding site | 379 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Active site | 468 | Proton acceptor; for kinase activity | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | EKC/KEOPS complex | |
Molecular Function | ATP binding | |
Molecular Function | iron ion binding | |
Molecular Function | metalloendopeptidase activity | |
Molecular Function | N(6)-L-threonylcarbamoyladenine synthase activity | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Molecular Function | protein serine/threonine/tyrosine kinase activity | |
Molecular Function | zinc ion binding | |
Biological Process | tRNA threonylcarbamoyladenosine modification |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProbable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein
Including 2 domains:
- Recommended nametRNA N6-adenosine threonylcarbamoyltransferase
- EC number
- Alternative names
- Recommended nameSerine/threonine-protein kinase Bud32
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Halobacteria > Halobacteriales > Haloferacaceae
Accessions
- Primary accessionA0A1I5Q3Q8
Proteomes
Subcellular Location
Interaction
Subunit
Component of the KEOPS complex that consists of Kae1, Bud32, Cgi121 and Pcc1; the whole complex dimerizes.
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-338 | Kae1 | ||||
Sequence: MRVLGVEGTAWCASAAVHDTETDETFIESDAYEPESGGIHPREAAEHMGDAVPRVIETALARADGDIDVVAFSKGPGLGPCLRVAGTAARALAGTLDVPLVGVNHMVAHLEIGRHESGFDSPVCLNASGANAHLLGFHDGRYRVLGETMDTGVGNAIDKFTRHLGWTHPGGPKVEEAAKDGEYVDLPYVVKGMDFSFSGLMSAAKDAVDDVSASEASGGPSAHRSDDGTPVEDVCFSLQEHVFAMLTEVSERALSLTGSDELVLGGGVGQNARLREMLAAMCEQRGAEFYAPEPRFLRDNAGMIAVLGAKMAAAGDTIAIADSAIDPDFRPDEVPVTW | ||||||
Domain | 26-305 | Gcp-like | ||||
Sequence: FIESDAYEPESGGIHPREAAEHMGDAVPRVIETALARADGDIDVVAFSKGPGLGPCLRVAGTAARALAGTLDVPLVGVNHMVAHLEIGRHESGFDSPVCLNASGANAHLLGFHDGRYRVLGETMDTGVGNAIDKFTRHLGWTHPGGPKVEEAAKDGEYVDLPYVVKGMDFSFSGLMSAAKDAVDDVSASEASGGPSAHRSDDGTPVEDVCFSLQEHVFAMLTEVSERALSLTGSDELVLGGGVGQNARLREMLAAMCEQRGAEFYAPEPRFLRDNAGMIA | ||||||
Region | 211-230 | Disordered | ||||
Sequence: VSASEASGGPSAHRSDDGTP |
Sequence similarities
In the C-terminal section; belongs to the protein kinase superfamily. Tyr protein kinase family. BUD32 subfamily.
In the N-terminal section; belongs to the KAE1 / TsaD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length548
- Mass (Da)58,200
- Last updated2017-04-12 v1
- Checksum645A0FD3E4E86C1F