A0A1B9VNQ5 · A0A1B9VNQ5_9PROT
- ProteinATP-dependent 6-phosphofructokinase
- GenepfkA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids368 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.
Catalytic activity
- ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H+
Cofactor
Pathway
Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 10 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 76-77 | ATP (UniProtKB | ChEBI) | ||||
Sequence: KG | ||||||
Binding site | 113-116 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GDGS | ||||||
Binding site | 114 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Site | 115 | Important for substrate specificity; cannot use PPi as phosphoryl donor | ||||
Sequence: G | ||||||
Binding site | 137-139 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: TID | ||||||
Active site | 139 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 174 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 181-183 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: MGR | ||||||
Binding site | 234 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: E | ||||||
Binding site | 275 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 281-284 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: HVQR |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | 6-phosphofructokinase complex | |
Molecular Function | 6-phosphofructokinase activity | |
Molecular Function | AMP binding | |
Molecular Function | ATP binding | |
Molecular Function | diphosphate-fructose-6-phosphate 1-phosphotransferase activity | |
Molecular Function | fructose-6-phosphate binding | |
Molecular Function | identical protein binding | |
Molecular Function | metal ion binding | |
Molecular Function | monosaccharide binding | |
Biological Process | canonical glycolysis | |
Biological Process | fructose 1,6-bisphosphate metabolic process | |
Biological Process | fructose 6-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent 6-phosphofructokinase
- EC number
- Short namesATP-PFK ; Phosphofructokinase
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Rhodospirillales > Thalassospiraceae > Thalassospira
Accessions
- Primary accessionA0A1B9VNQ5
Proteomes
Subcellular Location
Interaction
Subunit
Homodimer or homotetramer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-307 | Phosphofructokinase | ||||
Sequence: RIGILTSGGDCAGLNAVILAVVRRAVLGYGWDVVGIRQGTHGLMQDPPQAIDLNDYVNNDGMLRLGGTILGTVNKGDPFHYPMPDGSFADRSADVIAGYHKLGLDALIGVGGDGSMAILHRLAEMGGINLVGIPKTIDNDLALTEYSVGFTTAVNVAVEALDRLQPTAASHDRIMILEVMGRDAGHIALFAGVAGGADAILIPEMDYDLDALTEHCLNIRKRGRNHALVIVAEAVKRDDGAAVTQGDDGQKIRYGGIGHWLADELGARTGWETRVTVLGHVQRGGIPSPRDRVIASAFGVHAVDLI |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length368
- Mass (Da)38,954
- Last updated2016-11-02 v1
- Checksum2A3F530078979B2F
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MAJC01000002 EMBL· GenBank· DDBJ | OCK10079.1 EMBL· GenBank· DDBJ | Genomic DNA |