A0A1B1W4S3 · A0A1B1W4S3_ARATH
- ProteinATP synthase subunit c, chloroplastic
- GeneatpH
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
F1F0 ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F1 containing the extramembraneous catalytic core and F0 containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Key component of the F0 channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F1 delta and epsilon subunits.
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase.
Miscellaneous
In plastids the F-type ATPase is also known as CF1CF0.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 61 | Reversibly protonated during proton transport | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | proton-transporting ATP synthase complex, coupling factor F(o) | |
Molecular Function | lipid binding | |
Molecular Function | proton-transporting ATP synthase activity, rotational mechanism |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameATP synthase subunit c, chloroplastic
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A1B1W4S3
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 57-77 | Helical | ||||
Sequence: LAFMEALTIYGLVVALALLFA |
Keywords
- Cellular component
Expression
Gene expression databases
Interaction
Subunit
F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c.
F-type ATPases have 2 components, F1 - the catalytic core - and F0 - the membrane proton channel. F1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. F0 has four main subunits: a1, b1, b'1 and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F1 is attached to F0 by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta, b and b' chains.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-73 | V-ATPase proteolipid subunit C-like | ||||
Sequence: IAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALA |
Sequence similarities
Belongs to the ATPase C chain family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length81
- Mass (Da)7,976
- Last updated2016-11-02 v1
- Checksum2EA40BC2265B3CB9
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KX551970 EMBL· GenBank· DDBJ | ANW47777.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK353213 EMBL· GenBank· DDBJ | QBI37850.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK380719 EMBL· GenBank· DDBJ | QDK58742.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK380720 EMBL· GenBank· DDBJ | QDK58827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK380721 EMBL· GenBank· DDBJ | QDK58912.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MN603471 EMBL· GenBank· DDBJ | QXM16418.1 EMBL· GenBank· DDBJ | Genomic DNA |