A0A1B0GVV2 · A0A1B0GVV2_HUMAN
- ProteinRho guanine nucleotide exchange factor 9
- GeneARHGEF9
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids458 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Acts as a guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | guanyl-nucleotide exchange factor activity |
Names & Taxonomy
Protein names
- Recommended nameRho guanine nucleotide exchange factor 9
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A1B0GVV2
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 357 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with GPHN.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-67 | SH3 | ||||
Sequence: DSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVN | ||||||
Domain | 103-287 | DH | ||||
Sequence: MRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINER | ||||||
Domain | 318-425 | PH | ||||
Sequence: ELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREERK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length458
- Mass (Da)54,343
- Last updated2016-10-05 v1
- Checksum0FB5ABBAC49EFFEE
Computationally mapped potential isoform sequences
There are 22 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O43307 | ARHG9_HUMAN | ARHGEF9 | 516 | ||
A0A096LNQ4 | A0A096LNQ4_HUMAN | ARHGEF9 | 108 | ||
A0A096LNK4 | A0A096LNK4_HUMAN | ARHGEF9 | 110 | ||
A0A096LNK7 | A0A096LNK7_HUMAN | ARHGEF9 | 91 | ||
A0A096LPE7 | A0A096LPE7_HUMAN | ARHGEF9 | 134 | ||
A0A096LP05 | A0A096LP05_HUMAN | ARHGEF9 | 115 | ||
A0A096LPI8 | A0A096LPI8_HUMAN | ARHGEF9 | 136 | ||
A0A1B0GVC4 | A0A1B0GVC4_HUMAN | ARHGEF9 | 454 | ||
A0A1B0GV82 | A0A1B0GV82_HUMAN | ARHGEF9 | 455 | ||
A0A1B0GV84 | A0A1B0GV84_HUMAN | ARHGEF9 | 506 | ||
A0A1B0GU85 | A0A1B0GU85_HUMAN | ARHGEF9 | 35 | ||
A0A1B0GTF0 | A0A1B0GTF0_HUMAN | ARHGEF9 | 263 | ||
A0A1B0GWI5 | A0A1B0GWI5_HUMAN | ARHGEF9 | 529 | ||
A0A1B0GVX8 | A0A1B0GVX8_HUMAN | ARHGEF9 | 64 | ||
A0A1W2PQW9 | A0A1W2PQW9_HUMAN | ARHGEF9 | 56 | ||
A0A5F9ZI31 | A0A5F9ZI31_HUMAN | ARHGEF9 | 451 | ||
A0A5F9ZGZ3 | A0A5F9ZGZ3_HUMAN | ARHGEF9 | 489 | ||
A0A5F9ZHY9 | A0A5F9ZHY9_HUMAN | ARHGEF9 | 523 | ||
A0A0A6YYB3 | A0A0A6YYB3_HUMAN | ARHGEF9 | 483 | ||
A0A0A6YYF8 | A0A0A6YYF8_HUMAN | ARHGEF9 | 564 | ||
B1AMR3 | B1AMR3_HUMAN | ARHGEF9 | 495 | ||
B1AMR4 | B1AMR4_HUMAN | ARHGEF9 | 487 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL355142 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL391277 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL451106 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |