A0A1B0GUX3 · A0A1B0GUX3_HUMAN
- ProteinBattenin
- GeneCLN3
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids135 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | lysosomal membrane |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameBattenin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A1B0GUX3
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Lysosome membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 61-78 | Helical | ||||
Sequence: LLWYIVPLVVVYFAEYFI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: XLLLASYFLLLTSPEA | ||||||
Chain | PRO_5008408645 | 17-135 | Battenin | |||
Sequence: QDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQAGM |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusFragment
- Length135
- Mass (Da)15,509
- Last updated2016-10-05 v1
- ChecksumA5BB757E69232F04
Computationally mapped potential isoform sequences
There are 28 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q13286 | CLN3_HUMAN | CLN3 | 438 | ||
O95086 | O95086_HUMAN | CLN3 | 336 | ||
O95090 | O95090_HUMAN | CLN3 | 167 | ||
H3BUF8 | H3BUF8_HUMAN | CLN3 | 53 | ||
H3BRU8 | H3BRU8_HUMAN | CLN3 | 28 | ||
H3BR00 | H3BR00_HUMAN | CLN3 | 155 | ||
H3BR84 | H3BR84_HUMAN | CLN3 | 176 | ||
H3BPL0 | H3BPL0_HUMAN | CLN3 | 74 | ||
H3BQ48 | H3BQ48_HUMAN | CLN3 | 176 | ||
H3BNK7 | H3BNK7_HUMAN | CLN3 | 228 | ||
H3BMN4 | H3BMN4_HUMAN | CLN3 | 218 | ||
Q2TA70 | Q2TA70_HUMAN | CLN3 | 360 | ||
A0A1B0GUU4 | A0A1B0GUU4_HUMAN | CLN3 | 182 | ||
A0A1B0GV71 | A0A1B0GV71_HUMAN | CLN3 | 370 | ||
A0A1B0GV41 | A0A1B0GV41_HUMAN | CLN3 | 269 | ||
A0A1B0GUB1 | A0A1B0GUB1_HUMAN | CLN3 | 77 | ||
A0A1B0GTS8 | A0A1B0GTS8_HUMAN | CLN3 | 47 | ||
A0A1B0GWH8 | A0A1B0GWH8_HUMAN | CLN3 | 52 | ||
A0A1B0GWH9 | A0A1B0GWH9_HUMAN | CLN3 | 159 | ||
A0A1B0GWD3 | A0A1B0GWD3_HUMAN | CLN3 | 399 | ||
A0A1B0GW90 | A0A1B0GW90_HUMAN | CLN3 | 370 | ||
A0A1B0GW34 | A0A1B0GW34_HUMAN | CLN3 | 363 | ||
B4DFF3 | B4DFF3_HUMAN | CLN3 | 384 | ||
A0A0D9SF04 | A0A0D9SF04_HUMAN | CLN3 | 82 | ||
F6TI76 | F6TI76_HUMAN | CLN3 | 285 | ||
Q9UP10 | Q9UP10_HUMAN | CLN3 | 131 | ||
Q9UBD8 | Q9UBD8_HUMAN | CLN3 | 181 | ||
Q9UBH5 | Q9UBH5_HUMAN | CLN3 | 105 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: X |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC138894 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |