A0A179D368 · A0A179D368_9BACT
- ProteinMultifunctional fusion protein
- GenernhA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids375 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
Endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
Catalytic activity
- 2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate
Cofactor
Note: Binds 1 Mg2+ ion per subunit. May bind a second metal ion at a regulatory site, or after substrate binding.
Pathway
Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2-deoxy-alpha-D-ribose 1-phosphate: step 2/2.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 93 | Proton donor/acceptor | ||||
Sequence: D | ||||||
Active site | 155 | Schiff-base intermediate with acetaldehyde | ||||
Sequence: K | ||||||
Active site | 184 | Proton donor/acceptor | ||||
Sequence: K | ||||||
Binding site | 235 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 235 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 273 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 295 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 359 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | deoxyribose-phosphate aldolase activity | |
Molecular Function | magnesium ion binding | |
Molecular Function | nucleic acid binding | |
Molecular Function | RNA-DNA hybrid ribonuclease activity | |
Biological Process | 2-deoxyribose 1-phosphate catabolic process | |
Biological Process | carbohydrate catabolic process | |
Biological Process | deoxyribonucleotide catabolic process | |
Biological Process | RNA catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMultifunctional fusion protein
Including 2 domains:
- Recommended nameDeoxyribose-phosphate aldolase
- EC number
- Short namesDERA
- Alternative names
- Recommended nameRibonuclease H
- EC number
- Short namesRNase H
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Thermodesulfobacteriota > Thermodesulfobacteria > Thermodesulfobacteriales > Thermodesulfobacteriaceae > Thermosulfurimonas
Accessions
- Primary accessionA0A179D368
Proteomes
Subcellular Location
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 226-367 | RNase H type-1 | ||||
Sequence: PYEEVEIFIDGACLGNPGPGGFSAILRARGHEKVLTGGEAETTNNRMEIRAAVEALKALKKPSRVKMYTDSKYLLSGATDWLPRWEKRGFRTADGKPVKNRDLWEELSRLLKIHEVEWIWIEGHAGHPENERCDKLAKNEAK |
Sequence similarities
Belongs to the DeoC/FbaB aldolase family. DeoC type 1 subfamily.
Belongs to the RNase H family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length375
- Mass (Da)41,039
- Last updated2016-09-07 v1
- ChecksumE003DE5F426DB5B3
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LWLG01000010 EMBL· GenBank· DDBJ | OAQ20507.1 EMBL· GenBank· DDBJ | Genomic DNA |