A0A178UZY6 · A0A178UZY6_ARATH
- ProteinKinesin-like protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids745 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | microtubule | |
Molecular Function | ATP binding | |
Molecular Function | microtubule binding | |
Molecular Function | microtubule motor activity | |
Biological Process | microtubule-based movement |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameKinesin-like protein
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A178UZY6
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MVGEMTNNGRIRPSFPVKDLTSNEGSEYGGP | ||||||
Coiled coil | 76-223 | |||||
Sequence: FQELELDYAFEQEKLKNAMEMNEKHCADLEVNLKVKEEELNMVIDELRKNFASVQVQLAKEQTEKLAANESLGKEREARIAVESLQAAITEELAKTQGELQTANQRIQAVNDMYKLLQEYNSSLQLYNSKLQGDLDEAHENIKRGEKE | ||||||
Coiled coil | 259-380 | |||||
Sequence: KDELVNEIVSLKVEIQQVKDDRDRHITEIETLQAEATKQNDFKDTINELESKCSVQNKEIEELQDQLVASERKLQVADLSTFEKMNEFEEQKESIMELKGRLEEAELKLIEGEKLRKKLHNT | ||||||
Domain | 387-724 | Kinesin motor | ||||
Sequence: NIRVFCRVRPLLSGENSSEEAKTISYPTSLEALGRGIDLLQNGQSHCFTFDKVFVPSASQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPGNPDEKGLIPRCLEQIFQTRQSLRSQGWKYELQVSMLEIYNETIRDLLSTNKEAVRADNGVSPQKYAIKHDASGNTHVVELTVVDVRSSKQVSFLLDHAARNRSVGKTAMNEQSSRSHFVFTLKISGFNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLGDVIFALAKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNITPEPSSTGESLCSLRFAARVNAC |
Sequence similarities
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length745
- Mass (Da)84,359
- Last updated2016-09-07 v1
- Checksum6DB352FDF4FD7BC1
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CACSHJ010000095 EMBL· GenBank· DDBJ | CAA0396660.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LR881469 EMBL· GenBank· DDBJ | CAD5329221.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LUHQ01000004 EMBL· GenBank· DDBJ | OAO98362.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CACRSJ010000109 EMBL· GenBank· DDBJ | VYS64077.1 EMBL· GenBank· DDBJ | Genomic DNA |