A0A178U9Q0 · A0A178U9Q0_ARATH
- Proteinmagnesium chelatase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1381 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Catalytic activity
- ATP + H2O + Mg2+ + protoporphyrin IX = ADP + 3 H+ + Mg-protoporphyrin IX + phosphate
Pathway
Porphyrin-containing compound metabolism.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | magnesium chelatase activity | |
Biological Process | chlorophyll biosynthetic process | |
Biological Process | photosynthesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namemagnesium chelatase
- EC number
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A178U9Q0
- Secondary accessions
Proteomes
Genome annotation databases
Expression
Gene expression databases
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 79-240 | Magnesium chelatase subunit H N-terminal | ||||
Sequence: KIVYVVLEAQYQSSLSEAVQSLNKTSRFASYEVVGYLVEELRDKNTYNNFCEDLKDANIFIGSLIFVEELAIKVKDAVEKERDRMDAVLVFPSMPEVMRLNKLGSFSMSQLGQSKSPFFQLFKRKKQGSAGFADSMLKLVRTLPKVLKYLPSDKAQDARLYI |
Sequence similarities
Belongs to the Mg-chelatase subunit H family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,381
- Mass (Da)153,574
- Last updated2016-09-07 v1
- Checksum8EBAD26670A7B336
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CACSHJ010000096 EMBL· GenBank· DDBJ | CAA0402391.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LR881470 EMBL· GenBank· DDBJ | CAD5331592.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LUHQ01000005 EMBL· GenBank· DDBJ | OAO89867.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CACRSJ010000110 EMBL· GenBank· DDBJ | VYS66727.1 EMBL· GenBank· DDBJ | Genomic DNA |