A0A172FJ67 · A0A172FJ67_ZEADI
- ProteinNADH-quinone oxidoreductase subunit C
- GenendhJ
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids159 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Catalytic activity
- a quinone + NADH + 5 H+(in) = a quinol + NAD+ + 4 H+(out)
CHEBI:132124 + CHEBI:57945 + 5 H+ (in)CHEBI:15378= CHEBI:24646 + CHEBI:57540 + 4 H+ (out)CHEBI:15378
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | plasma membrane | |
Molecular Function | NADH dehydrogenase (ubiquinone) activity | |
Molecular Function | NADH:ubiquinone reductase (non-electrogenic) activity | |
Molecular Function | quinone binding |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADH-quinone oxidoreductase subunit C
- EC number
- Alternative names
Gene names
Encoded on
- Plastid
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > PACMAD clade > Panicoideae > Andropogonodae > Andropogoneae > Tripsacinae > Zea
Accessions
- Primary accessionA0A172FJ67
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Interaction
Subunit
NDH-1 is composed of 14 different subunits. Subunits NuoB, C, D, E, F, and G constitute the peripheral sector of the complex.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-149 | NADH:ubiquinone oxidoreductase 30kDa subunit | ||||
Sequence: QIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWVWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYIT |
Sequence similarities
Belongs to the complex I 30 kDa subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length159
- Mass (Da)18,669
- Last updated2016-09-07 v1
- ChecksumBFAEA6E22113C62F
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KR873421 EMBL· GenBank· DDBJ | ALS45715.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT610091 EMBL· GenBank· DDBJ | QVO55272.1 EMBL· GenBank· DDBJ | Genomic DNA |