A0A169MW97 · A0A169MW97_9REOV
- ProteinNon-structural protein 2
- GeneNSP2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids312 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Participates in replication and packaging of the viral genome. Plays a crucial role, together with NSP5, in the formation of virus factories (viroplasms) which are large inclusions in the host cytoplasm where replication intermediates are assembled and viral RNA replication takes place. Displays ssRNA binding, NTPase, RNA triphosphatase (RTPase) and ATP-independent helix-unwinding activities. The unwinding activity may prepare and organize plus-strand RNAs for packaging and replication by removing interfering secondary structures. The RTPase activity plays a role in the removal of the gamma-phosphate from the rotavirus RNA minus strands of dsRNA genome segments. Participates in the selective exclusion of host proteins from stress granules (SG) and P bodies (PB). Participates also in the sequestration of these remodeled organelles in viral factories.
Cofactor
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | nucleoside diphosphate kinase activity | |
Molecular Function | ribonucleoside triphosphate phosphatase activity | |
Molecular Function | RNA binding | |
Biological Process | viral genome replication |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNon-structural protein 2
- EC number
- Short namesNSP2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Duplornaviricota > Resentoviricetes > Reovirales > Sedoreoviridae > Rotavirus > Rotavirus C
Accessions
- Primary accessionA0A169MW97
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in spherical cytoplasmic structures, called viral factories, that appear early after infection and are the site of viral replication and packaging.
Keywords
- Cellular component
Interaction
Subunit
Homooctamer. Interacts with VP1; this interaction is weak. Interacts with NSP5; this interaction leads to up-regulation of NSP5 phosphorylation and formation of viral factories. Interacts with host DCP1A, DCP1B, DDX6, EDC4 and EIF2S1/eIF2-alpha; these interactions are probably part of the sequestration of some host SGs and PBs proteins in viral factories.
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-143 | Rotavirus non-structural protein 35 N-terminal | ||||
Sequence: AELACFVSFSLTEDKVVWFPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNERYGLDYESDQYTEVASLLSDVLTMVSMPTEKFQFDIVKTVVQVRHLENLLYRIKDANDILNVNVKLRVKAVMIACNLV | ||||||
Domain | 144-311 | Rotavirus non-structural protein 35 C-terminal | ||||
Sequence: NETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMADEYKITINTKTDIPDRNQTTFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERFDRKIKSDKKHGRQFSYDDGDMAFVHPGWKTCIGQLCGGTTFEVAKTSLYSIKPSKTVRTATNKIESDLISMVG | ||||||
Region | 202-238 | RNA-binding | ||||
Sequence: FAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERF |
Sequence similarities
Belongs to the rotavirus NSP2 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length312
- Mass (Da)35,955
- Last updated2016-07-06 v1
- Checksum1447E7F044D3F6F3