A0A140T9R2 · A0A140T9R2_HUMAN
- ProteinMajor histocompatibility complex, class II, DM beta
- GeneHLA-DMB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids175 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | MHC class II protein complex | |
Biological Process | antigen processing and presentation | |
Biological Process | immune response |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A140T9R2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 132 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MGHEQNQGAALLQMLPLLWLLPHSWA | ||||||
Chain | PRO_5007305559 | 27-175 | ||||
Sequence: VPEEQSMITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPA |
Keywords
- PTM
Proteomic databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 59-137 | MHC class II beta chain N-terminal | ||||
Sequence: STCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFW |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length175
- Mass (Da)19,438
- Last updated2016-05-11 v1
- Checksum7C8B3677DE7E6717
Computationally mapped potential isoform sequences
There are 25 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P28068 | DMB_HUMAN | HLA-DMB | 263 | ||
H0Y7A2 | H0Y7A2_HUMAN | HLA-DMB | 141 | ||
H0Y4B8 | H0Y4B8_HUMAN | HLA-DMB | 106 | ||
A0A140T9T8 | A0A140T9T8_HUMAN | HLA-DMB | 175 | ||
A0A140T9U6 | A0A140T9U6_HUMAN | HLA-DMB | 175 | ||
A0A140T9K0 | A0A140T9K0_HUMAN | HLA-DMB | 106 | ||
A0A140T9K4 | A0A140T9K4_HUMAN | HLA-DMB | 106 | ||
A0A140T9K9 | A0A140T9K9_HUMAN | HLA-DMB | 106 | ||
A0A140T9Q5 | A0A140T9Q5_HUMAN | HLA-DMB | 141 | ||
A0A140T9Q8 | A0A140T9Q8_HUMAN | HLA-DMB | 106 | ||
A0A140T9R0 | A0A140T9R0_HUMAN | HLA-DMB | 175 | ||
A0A140T9C6 | A0A140T9C6_HUMAN | HLA-DMB | 141 | ||
A0A140T9C9 | A0A140T9C9_HUMAN | HLA-DMB | 175 | ||
A0A140T9E3 | A0A140T9E3_HUMAN | HLA-DMB | 141 | ||
A0A140T9F5 | A0A140T9F5_HUMAN | HLA-DMB | 141 | ||
A0A140T9F6 | A0A140T9F6_HUMAN | HLA-DMB | 106 | ||
A0A140T9I2 | A0A140T9I2_HUMAN | HLA-DMB | 175 | ||
A0A140T926 | A0A140T926_HUMAN | HLA-DMB | 175 | ||
A0A140T943 | A0A140T943_HUMAN | HLA-DMB | 106 | ||
A0A140T9B6 | A0A140T9B6_HUMAN | HLA-DMB | 141 | ||
A0A140T946 | A0A140T946_HUMAN | HLA-DMB | 106 | ||
A0A140T965 | A0A140T965_HUMAN | HLA-DMB | 141 | ||
A0A140T987 | A0A140T987_HUMAN | HLA-DMB | 141 | ||
A0A0G2JIJ2 | A0A0G2JIJ2_HUMAN | HLA-DMB | 257 | ||
A0A0G2JI43 | A0A0G2JI43_HUMAN | HLA-DMB | 257 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 175 | |||||
Sequence: A |
Keywords
- Technical term