A0A140T9J5 · A0A140T9J5_HUMAN
- ProteinCoiled-coil alpha-helical rod protein 1
- GeneCCHCR1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids316 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
May be a regulator of keratinocyte proliferation or differentiation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Biological Process | cell differentiation |
Names & Taxonomy
Protein names
- Recommended nameCoiled-coil alpha-helical rod protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A140T9J5
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 207 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-47 | Disordered | ||||
Sequence: MFPPSGHQDVSERRLDTQRPQVTMWERDVSSDRQEPGRRGRSWGLEG | ||||||
Compositional bias | 9-40 | Basic and acidic residues | ||||
Sequence: DVSERRLDTQRPQVTMWERDVSSDRQEPGRRG | ||||||
Coiled coil | 48-96 | |||||
Sequence: SQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRLEAQAMELEAL | ||||||
Compositional bias | 141-166 | Polar residues | ||||
Sequence: EQLSSLTQAHEEALSSLTSKAEGLEK | ||||||
Region | 141-182 | Disordered | ||||
Sequence: EQLSSLTQAHEEALSSLTSKAEGLEKSLSSLETRRAGEAKEL | ||||||
Compositional bias | 167-182 | Basic and acidic residues | ||||
Sequence: SLSSLETRRAGEAKEL |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length316
- Mass (Da)36,333
- Last updated2016-05-11 v1
- ChecksumD81FAEA583141219
Computationally mapped potential isoform sequences
There are 37 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q8TD31 | CCHCR_HUMAN | CCHCR1 | 782 | ||
A2ABH1 | A2ABH1_HUMAN | CCHCR1 | 729 | ||
A2ABH3 | A2ABH3_HUMAN | CCHCR1 | 188 | ||
A2ABH4 | A2ABH4_HUMAN | CCHCR1 | 152 | ||
A2ABH5 | A2ABH5_HUMAN | CCHCR1 | 216 | ||
B0V092 | B0V092_HUMAN | CCHCR1 | 118 | ||
E7EPK4 | E7EPK4_HUMAN | CCHCR1 | 191 | ||
E7EQC5 | E7EQC5_HUMAN | CCHCR1 | 140 | ||
E7EQE8 | E7EQE8_HUMAN | CCHCR1 | 139 | ||
B0S7V6 | B0S7V6_HUMAN | CCHCR1 | 782 | ||
D6RBG1 | D6RBG1_HUMAN | CCHCR1 | 41 | ||
D6RB88 | D6RB88_HUMAN | CCHCR1 | 96 | ||
D6RAE7 | D6RAE7_HUMAN | CCHCR1 | 126 | ||
D6RE89 | D6RE89_HUMAN | CCHCR1 | 44 | ||
D6RDI7 | D6RDI7_HUMAN | CCHCR1 | 115 | ||
D6RD84 | D6RD84_HUMAN | CCHCR1 | 36 | ||
D6RA02 | D6RA02_HUMAN | CCHCR1 | 80 | ||
D6R9W9 | D6R9W9_HUMAN | CCHCR1 | 80 | ||
Q5STF0 | Q5STF0_HUMAN | CCHCR1 | 126 | ||
A0A0G2JP87 | A0A0G2JP87_HUMAN | CCHCR1 | 870 | ||
A0A0G2JPU2 | A0A0G2JPU2_HUMAN | CCHCR1 | 870 | ||
E9PHV1 | E9PHV1_HUMAN | CCHCR1 | 159 | ||
A0A494C023 | A0A494C023_HUMAN | CCHCR1 | 379 | ||
E9PGB6 | E9PGB6_HUMAN | CCHCR1 | 158 | ||
A0A494C0D7 | A0A494C0D7_HUMAN | CCHCR1 | 365 | ||
A0A0G2JJZ1 | A0A0G2JJZ1_HUMAN | CCHCR1 | 188 | ||
A0A0G2JII5 | A0A0G2JII5_HUMAN | CCHCR1 | 729 | ||
A0A0G2JHL3 | A0A0G2JHL3_HUMAN | CCHCR1 | 256 | ||
A0A0G2JHL6 | A0A0G2JHL6_HUMAN | CCHCR1 | 256 | ||
A0A0G2JHN4 | A0A0G2JHN4_HUMAN | CCHCR1 | 316 | ||
A0A0G2JI86 | A0A0G2JI86_HUMAN | CCHCR1 | 118 | ||
A0A0G2JI40 | A0A0G2JI40_HUMAN | CCHCR1 | 171 | ||
A0A0G2JJK2 | A0A0G2JJK2_HUMAN | CCHCR1 | 316 | ||
A0A0G2JJK7 | A0A0G2JJK7_HUMAN | CCHCR1 | 152 | ||
A0A0G2JIL2 | A0A0G2JIL2_HUMAN | CCHCR1 | 171 | ||
A0A0G2JJ47 | A0A0G2JJ47_HUMAN | CCHCR1 | 729 | ||
A0A0G2JIT9 | A0A0G2JIT9_HUMAN | CCHCR1 | 188 |
Features
Showing features for compositional bias, non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 9-40 | Basic and acidic residues | ||||
Sequence: DVSERRLDTQRPQVTMWERDVSSDRQEPGRRG | ||||||
Compositional bias | 141-166 | Polar residues | ||||
Sequence: EQLSSLTQAHEEALSSLTSKAEGLEK | ||||||
Compositional bias | 167-182 | Basic and acidic residues | ||||
Sequence: SLSSLETRRAGEAKEL | ||||||
Non-terminal residue | 316 | |||||
Sequence: E |
Keywords
- Technical term