A0A126HHL2 · A0A126HHL2_9CAUD
- ProteinDnaB-like replicative helicase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids427 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
ATP-dependent DNA helicase essential for viral DNA replication and recombination. The helicase moves 5' -> 3' on the lagging strand template, unwinding the DNA duplex ahead of the leading strand polymerase at the replication fork and generating ssDNA for both leading and lagging strand synthesis. Interaction with the primase allows the primase to initiate lagging strand synthesis and fully activates the helicase. Loaded by the helicase assembly factor on replication forks that begin at discrete replication origin sequences, as well as on forks that are created during recombination.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Molecular Function | DNA helicase activity | |
Molecular Function | hydrolase activity | |
Biological Process | DNA replication | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDnaB-like replicative helicase
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Straboviridae > Schizotequatrovirus
Accessions
- Primary accessionA0A126HHL2
Proteomes
Interaction
Subunit
Homohexamer. The homohexamer is a trimer of asymmetric dimers. Interacts with the DNA primase; this interaction forms the active primosome complex, which is composed of 6 helicase and 1 primase subunits and expresses full helicase and primase activities. Interacts (via C-terminus) with the helicase assembly factor; this interaction brings about the rapid assembly of the helicase onto ssDNA. Part of the replicase complex that includes the DNA polymerase, the polymerase clamp, the clamp loader complex, the single-stranded DNA binding protein, the primase, the DnaB-like replicative helicase and the helicase assembly factor.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 130-396 | SF4 helicase | ||||
Sequence: YIEKAAKIPFKMNILNKITQGGVERSTLNLLLAGSNVGKSLALCHLATEYLLQGYNVLYISMEMSEAAVSKRIDANLMDISMDDFDTITEKTYGTKIQNLEKKTQGKLFIKQFPTAGANVTHFNTLMNELRTKKDVIPDIVIVDYLGICASSRVASSENTYVHVKAIAEEIRGFAVEHNVAVWSAAQTTRNAWDASDMGMGDIAESAGLAHTADLILGIMETEETVALGQQRVKQIKSRYADRNQDQTFMIAVNKGKQRWGDVDGTA | ||||||
Region | 392-427 | Disordered | ||||
Sequence: VDGTASYTAPAQSQTQSATPFAQKKEQTQKAEAVNW | ||||||
Compositional bias | 397-427 | Polar residues | ||||
Sequence: SYTAPAQSQTQSATPFAQKKEQTQKAEAVNW |
Sequence similarities
Belongs to the helicase family. DnaB subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length427
- Mass (Da)47,755
- Last updated2016-05-11 v1
- Checksum57E9B3CE2921E12F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 397-427 | Polar residues | ||||
Sequence: SYTAPAQSQTQSATPFAQKKEQTQKAEAVNW |