A0A0U1RQT0 · A0A0U1RQT0_HUMAN
- ProteinGlutaminyl-tRNA synthetase 1
- GeneQARS1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids342 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glutamine-tRNA ligase activity | |
Biological Process | glutaminyl-tRNA aminoacylation |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A0U1RQT0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 415 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 16 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 70 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-162 | Glutaminyl-tRNA synthetase class Ib non-specific RNA-binding | ||||
Sequence: LSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLSFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADG | ||||||
Domain | 165-254 | Glutaminyl-tRNA synthetase class Ib non-specific RNA-binding | ||||
Sequence: IKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLK | ||||||
Domain | 263-340 | Glutamyl/glutaminyl-tRNA synthetase class Ib catalytic | ||||
Sequence: QANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGHN |
Sequence similarities
Belongs to the class-I aminoacyl-tRNA synthetase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length342
- Mass (Da)38,501
- Last updated2016-02-17 v1
- ChecksumB265E52949218AE4
Computationally mapped potential isoform sequences
There are 22 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P47897 | SYQ_HUMAN | QARS1 | 775 | ||
C9J165 | C9J165_HUMAN | QARS1 | 339 | ||
A0A0U1RQQ5 | A0A0U1RQQ5_HUMAN | QARS1 | 194 | ||
A0A0U1RQJ6 | A0A0U1RQJ6_HUMAN | QARS1 | 96 | ||
A0A0U1RQL2 | A0A0U1RQL2_HUMAN | QARS1 | 191 | ||
A0A0U1RQM8 | A0A0U1RQM8_HUMAN | QARS1 | 173 | ||
A0A0U1RQX5 | A0A0U1RQX5_HUMAN | QARS1 | 134 | ||
A0A0U1RQX9 | A0A0U1RQX9_HUMAN | QARS1 | 83 | ||
A0A0U1RQU2 | A0A0U1RQU2_HUMAN | QARS1 | 174 | ||
A0A0U1RR66 | A0A0U1RR66_HUMAN | QARS1 | 173 | ||
A0A0U1RR79 | A0A0U1RR79_HUMAN | QARS1 | 75 | ||
A0A0U1RQC3 | A0A0U1RQC3_HUMAN | QARS1 | 67 | ||
A0A0U1RQE9 | A0A0U1RQE9_HUMAN | QARS1 | 187 | ||
A0A0U1RRC8 | A0A0U1RRC8_HUMAN | QARS1 | 91 | ||
A0A0U1RRI9 | A0A0U1RRI9_HUMAN | QARS1 | 182 | ||
A0A0U1RRJ7 | A0A0U1RRJ7_HUMAN | QARS1 | 68 | ||
A0A1B0GTT3 | A0A1B0GTT3_HUMAN | QARS1 | 169 | ||
A0A1B0GU21 | A0A1B0GU21_HUMAN | QARS1 | 44 | ||
A0A1B0GVU9 | A0A1B0GVU9_HUMAN | QARS1 | 736 | ||
B4DDN1 | B4DDN1_HUMAN | QARS1 | 630 | ||
H7C0R3 | H7C0R3_HUMAN | QARS1 | 253 | ||
F2Z2V6 | F2Z2V6_HUMAN | QARS1 | 100 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 342 | |||||
Sequence: L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC135506 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |