A0A0S2Z4P6 · A0A0S2Z4P6_HUMAN
- ProteinBeta-transducin repeat containing isoform 1
- GeneBTRC
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids605 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | beta-catenin binding | |
Molecular Function | protein dimerization activity | |
Molecular Function | protein phosphorylated amino acid binding | |
Molecular Function | ubiquitin protein ligase activity | |
Biological Process | branching involved in mammary gland duct morphogenesis | |
Biological Process | cellular response to organic cyclic compound | |
Biological Process | mammary gland epithelial cell proliferation | |
Biological Process | positive regulation of circadian rhythm | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | protein K48-linked ubiquitination | |
Biological Process | regulation of canonical NF-kappaB signal transduction | |
Biological Process | regulation of canonical Wnt signaling pathway | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of proteasomal protein catabolic process | |
Biological Process | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A0S2Z4P6
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Organism-specific databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 190-228 | F-box | ||||
Sequence: DHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKL | ||||||
Repeat | 312-329 | WD | ||||
Sequence: DDQKIVSGLRDNTIKIWD | ||||||
Repeat | 339-378 | WD | ||||
Sequence: LTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNT | ||||||
Repeat | 379-418 | WD | ||||
Sequence: LIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITL | ||||||
Repeat | 422-461 | WD | ||||
Sequence: LVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRT | ||||||
Repeat | 462-501 | WD | ||||
Sequence: LNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRV | ||||||
Repeat | 502-533 | WD | ||||
Sequence: LEGHEELVRCIRFDNKRIVSGAYDGKIKVWDL | ||||||
Repeat | 551-590 | WD | ||||
Sequence: LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length605
- Mass (Da)68,867
- Last updated2016-02-17 v1
- Checksum4C67F3B7E400FD37
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 605 | |||||
Sequence: R |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KU178451 EMBL· GenBank· DDBJ | ALQ33909.1 EMBL· GenBank· DDBJ | mRNA |