A0A0R4IEW8 · ELAV4_DANRE
- ProteinELAV-like protein 4
- Geneelavl4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids411 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
RNA-binding protein that is involved in the post-transcriptional regulation of mRNAs (By similarity).
Plays a role in the regulation of mRNA stability, alternative splicing and translation (By similarity).
Binds to AU-rich element (ARE) sequences in the 3' untranslated region (3'UTR) of target mRNAs (By similarity).
Mainly plays a role in neuron-specific RNA processing (By similarity).
Required for the maturation of motor neuron axonal branches and dendrites (PubMed:29061699).
Plays a role in the regulation of mRNA stability, alternative splicing and translation (By similarity).
Binds to AU-rich element (ARE) sequences in the 3' untranslated region (3'UTR) of target mRNAs (By similarity).
Mainly plays a role in neuron-specific RNA processing (By similarity).
Required for the maturation of motor neuron axonal branches and dendrites (PubMed:29061699).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | cytoplasm | |
Cellular Component | dendrite | |
Cellular Component | growth cone | |
Cellular Component | perikaryon | |
Cellular Component | protein-containing complex | |
Cellular Component | ribonucleoprotein complex | |
Molecular Function | RNA binding | |
Biological Process | axonogenesis | |
Biological Process | mRNA processing | |
Biological Process | RNA splicing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameELAV-like protein 4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A0R4IEW8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduced overall movement, decreased initiation of swim and turn movements and decreased mean body curvature change per swim half-cycle and mean number of swim half-cycles per swim (PubMed:29061699).
At 2 and 4 dpf, decreased axonal branches and at 4 dpf, decreased dendrites in motor neurons (PubMed:29061699).
Defects on motor neuron extensions persist at 26 dph (PubMed:29061699).
Decreased GAP43 mRNA levels (PubMed:29061699).
At 2 and 4 dpf, decreased axonal branches and at 4 dpf, decreased dendrites in motor neurons (PubMed:29061699).
Defects on motor neuron extensions persist at 26 dph (PubMed:29061699).
Decreased GAP43 mRNA levels (PubMed:29061699).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000447878 | 1-411 | ELAV-like protein 4 | |||
Sequence: MFEISRTLNAALLSNEGSTETQWRQADLPQLQGWAEKGLLTQPKMIISNMEPQVTNGPNSATANGPSSNSRSCPSPMQTGGSNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKTHKS |
Proteomic databases
Expression
Interaction
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 50-89 | Disordered | ||||
Sequence: MEPQVTNGPNSATANGPSSNSRSCPSPMQTGGSNDDSKTN | ||||||
Domain | 88-166 | RRM 1 | ||||
Sequence: TNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARP | ||||||
Domain | 174-257 | RRM 2 | ||||
Sequence: ANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANN | ||||||
Domain | 328-406 | RRM 3 | ||||
Sequence: WCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTN |
Sequence similarities
Belongs to the RRM elav family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length411
- Mass (Da)45,258
- Last updated2018-06-20 v2
- Checksum313C6063DEFE38F4
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M6Z808 | A0A8M6Z808_DANRE | elavl4 | 369 | ||
A0A8M9Q398 | A0A8M9Q398_DANRE | elavl4 | 408 | ||
A0A8M9Q9I0 | A0A8M9Q9I0_DANRE | elavl4 | 398 | ||
A0A8M2BEA7 | A0A8M2BEA7_DANRE | elavl4 | 382 | ||
A0A8M9QIF9 | A0A8M9QIF9_DANRE | elavl4 | 395 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR931780 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CU467068 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CU929301 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
U17602 EMBL· GenBank· DDBJ | AAA96940.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC065965 EMBL· GenBank· DDBJ | AAH65965.2 EMBL· GenBank· DDBJ | mRNA | Different initiation |