A0A0Q5A5Q4 · A0A0Q5A5Q4_9MICO
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids504 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- ATP + glycerol = ADP + H+ + sn-glycerol 3-phosphate
Activity regulation
Inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 12 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 12 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 12 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 13 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 14 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 16 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 82 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 82 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 83 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 83 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 134 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 134 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 246 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 246 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 247 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 268 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 268 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 312 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 312 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 316 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 413 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 413 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 417 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Micrococcales > Microbacteriaceae > Rathayibacter
Accessions
- Primary accessionA0A0Q5A5Q4
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-253 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: YVIAIDQGTTSSRAIIFDKKGSIVSTGQKEHEQIFPRAGWVEHDPIEIWNNVREVIGQALSRADLTRHDIAAVGITNQRETAVVWDKTTGKPVYNAIVWQDTRTQSIVDRLAGDVGADRFKSVVGLPLATYFSGTKIVWILENVEGAREKAEAGDLLFGTTDTWVLWNLTGGTDGGVHKTDVTNASRTLFLDLETLEWRDDILEAFGVPKSMLPEVCSSSEVYGQVEASSLLREVPIAGILGDQQAATFG | ||||||
Domain | 263-452 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: KNTYGTGNFLIFNTGTEIVHSKNGLLTTIGYKLGDGEVHYALEGSIAVSGSLIQWLRDNLGLIGSAPEVEALAATVEDNGGAYFVPAFSGLFAPYWRSDARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVPLQELKVDGGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length504
- Mass (Da)54,726
- Last updated2016-01-20 v1
- ChecksumE017392426A7CDA5
Keywords
- Technical term