A0A0P8LI41 · A0A0P8LI41_9ENTR
- ProteinGlucosamine-6-phosphate deaminase
- GenenagB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids266 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
Catalytic activity
- alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6-phosphate + NH4+
Activity regulation
Allosterically activated by N-acetylglucosamine 6-phosphate (GlcNAc6P).
Pathway
Amino-sugar metabolism; N-acetylneuraminate degradation; D-fructose 6-phosphate from N-acetylneuraminate: step 5/5.
Features
Showing features for active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 72 | Proton acceptor; for enolization step | ||||
Sequence: D | ||||||
Active site | 141 | For ring-opening step | ||||
Sequence: D | ||||||
Active site | 143 | Proton acceptor; for ring-opening step | ||||
Sequence: H | ||||||
Active site | 148 | For ring-opening step | ||||
Sequence: E | ||||||
Site | 151 | Part of the allosteric site | ||||
Sequence: S | ||||||
Site | 158 | Part of the allosteric site | ||||
Sequence: R | ||||||
Site | 160 | Part of the allosteric site | ||||
Sequence: K | ||||||
Site | 161 | Part of the allosteric site | ||||
Sequence: T |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | glucosamine-6-phosphate deaminase activity | |
Biological Process | carbohydrate metabolic process | |
Biological Process | N-acetylglucosamine metabolic process | |
Biological Process | N-acetylneuraminate catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlucosamine-6-phosphate deaminase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Enterobacter > Enterobacter cloacae complex
Accessions
- Primary accessionA0A0P8LI41
- Secondary accessions
Proteomes
Interaction
Subunit
Homohexamer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-229 | Glucosamine/galactosamine-6-phosphate isomerase | ||||
Sequence: TAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPLTAYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKDHPESYHSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDGDVNQVPKYALTVGVGTLLDAEEVMILVLGGVKAQALQAAVEGNVNHMWTISCL |
Sequence similarities
Belongs to the glucosamine/galactosamine-6-phosphate isomerase family. NagB subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length266
- Mass (Da)29,522
- Last updated2016-10-05 v1
- Checksum306673C2301066D3
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LEES01000017 EMBL· GenBank· DDBJ | KLP56611.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JAFKCP010000001 EMBL· GenBank· DDBJ | MBU3765460.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FKDK01000001 EMBL· GenBank· DDBJ | SAA01620.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FKHS01000012 EMBL· GenBank· DDBJ | SAI13617.1 EMBL· GenBank· DDBJ | Genomic DNA |