A0A0P0V1R2 · A0A0P0V1R2_ORYSJ
- ProteinPresenilin
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids416 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | gamma-secretase complex | |
Cellular Component | Golgi membrane | |
Cellular Component | Golgi-associated vesicle | |
Molecular Function | aspartic endopeptidase activity, intramembrane cleaving | |
Molecular Function | endopeptidase activity | |
Biological Process | membrane protein ectodomain proteolysis | |
Biological Process | Notch signaling pathway | |
Biological Process | protein processing |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePresenilin
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionA0A0P0V1R2
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Golgi apparatus membrane ; Multi-pass membrane protein
Keywords
- Cellular component
PTM/Processing
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 212-280 | Disordered | ||||
Sequence: QPVADPGRSGGNQYDRVEQEDDSSRAVVEMRDVGGSRSSIRERNLEREAPMAVSVSGHSSNQGGSSQHA | ||||||
Compositional bias | 225-239 | Basic and acidic residues | ||||
Sequence: YDRVEQEDDSSRAVV | ||||||
Compositional bias | 265-280 | Polar residues | ||||
Sequence: SVSGHSSNQGGSSQHA | ||||||
Region | 300-319 | Disordered | ||||
Sequence: SANNAAPNEEHRENSSSDSG |
Domain
The PAL motif is required for normal active site conformation.
Sequence similarities
Belongs to the peptidase A22A family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length416
- Mass (Da)44,306
- Last updated2016-01-20 v1
- ChecksumC960B9D968D11B5D
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: A | ||||||
Compositional bias | 225-239 | Basic and acidic residues | ||||
Sequence: YDRVEQEDDSSRAVV | ||||||
Compositional bias | 265-280 | Polar residues | ||||
Sequence: SVSGHSSNQGGSSQHA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP014957 EMBL· GenBank· DDBJ | BAS71550.1 EMBL· GenBank· DDBJ | Genomic DNA |